| Title: | Analyze Experimental High-Throughput (Omics) Data |
|---|---|
| Description: | The efficient treatment and convenient analysis of experimental high-throughput (omics) data gets facilitated through this collection of diverse functions. Several functions address advanced object-conversions, like manipulating lists of lists or lists of arrays, reorganizing lists to arrays or into separate vectors, merging of multiple entries, etc. Another set of functions provides speed-optimized calculation of standard deviation (sd), coefficient of variance (CV) or standard error of the mean (SEM) for data in matrixes or means per line with respect to additional grouping (eg n groups of replicates). A group of functions facilitate dealing with non-redundant information, by indexing unique, adding counters to redundant or eliminating lines with respect redundancy in a given reference-column, etc. Help is provided to identify very closely matching numeric values to generate (partial) distance matrixes for very big data in a memory efficient manner or to reduce the complexity of large data-sets by combining very close values. Other functions help aligning a matrix or data.frame to a reference using partial matching or to mine an experimental setup to extract patterns of replicate samples. Many times large experimental datasets need some additional filtering, adequate functions are provided. Convenient data normalization is supported in various different modes, parameter estimation via permutations or boot-strap as well as flexible testing of multiple pair-wise combinations using the framework of 'limma' is provided, too. Batch reading (or writing) of sets of files and combining data to arrays is supported, too. |
| Authors: | Wolfgang Raffelsberger [aut, cre] |
| Maintainer: | Wolfgang Raffelsberger <[email protected]> |
| License: | GPL-3 |
| Version: | 2.1.1 |
| Built: | 2026-07-20 18:46:07 UTC |
| Source: | https://github.com/cran/wrMisc |
This function allows to add 'addChr' to all entries, without the last entry
.addLetterWoLast(x, addChr).addLetterWoLast(x, addChr)
x |
(character) main input |
addChr |
(character) |
This function returns a modified character vector
paste; used in cutAtMultSites
.addLetterWoLast(c("abc","efgh"),"Z").addLetterWoLast(c("abc","efgh"),"Z")
This function calculates ratio(s) for each column of matrix 'x' versus all/each column(s) of matrix 'y' (reference)
.allRatioMatr1to2(x, y, asLog2 = TRUE, sumMeth = "mean", callFrom = NULL).allRatioMatr1to2(x, y, asLog2 = TRUE, sumMeth = "mean", callFrom = NULL)
x |
(matrix or data.frame) main input1 |
y |
(matrix or data.frame) main input2 |
asLog2 |
(logical) |
sumMeth |
(character) method |
callFrom |
(character) allow easier tracking of messages produced |
This function returns a numeric vector or matrix in dimension of 'x' (so far summarize all ratios from mult division from mult ref cols as mean or median )
.allRatioMatr1to2(matrix(11:14, ncol=2), matrix(21:24, ncol=2)).allRatioMatr1to2(matrix(11:14, ncol=2), matrix(21:24, ncol=2))
This function extracts/cuts text-fragments out of txt following specific anchors defined by arguments cutFrom and cutTo.
.allRatios(dat, ty = "log2", colNaSep = "_").allRatios(dat, ty = "log2", colNaSep = "_")
dat |
(matrix or data.frame) main input |
ty |
(character) type of ratio (eg 'log2') |
colNaSep |
(character) separator |
This function returns a numeric vector
.allRatios(matrix(11:14, ncol=2)).allRatios(matrix(11:14, ncol=2))
This function allows summarizing along columns of multiple arrays in list
.arrLstMean( arrLst, sumType = "mean", arrOutp = FALSE, signifDig = 3, formatCheck = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL ).arrLstMean( arrLst, sumType = "mean", arrOutp = FALSE, signifDig = 3, formatCheck = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )
arrLst |
(list) main input |
sumType |
(character) |
arrOutp |
(logical) |
signifDig |
(integer) |
formatCheck |
(logical) |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
array (1st dim will be summary along cols, rows will be layers of 3rd array-dim
used in cutArrayInCluLike
.datSlope(c(3:6)).datSlope(c(3:6))
This function allows summarizing along columns of mult arrays in list
.arrLstSEM( arrLst, arrOutp = FALSE, signifDig = 3, formatCheck = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL ).arrLstSEM( arrLst, arrOutp = FALSE, signifDig = 3, formatCheck = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )
arrLst |
(list) main input |
arrOutp |
(logical) |
signifDig |
(integer) |
formatCheck |
(logical) |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
array (1st dim will be summary along cols, rows will be layers of 3rd array-dim ie dim(arrLst[[1]])[3])
used in cutArrayInCluLike
.datSlope(c(3:6)).datSlope(c(3:6))
This function allows converting anything to data.frame
.asDF2(z).asDF2(z)
z |
(numeric vector, factor, matrix or list) main input |
data.frame
.asDF2(c(3:6)).asDF2(c(3:6))
This function aims to get series of values after last discontinuity
.breakInSer(x, getFrom = "last").breakInSer(x, getFrom = "last")
x |
(numeric) main input |
getFrom |
(character) |
This function returns a numeric vector of reduced length
.breakInSer(c(11:14,16:18)).breakInSer(c(11:14,16:18))
This function aims to bring most extreme value to center
.bringToCtr(aa, ctr, ctrFa = 0.75).bringToCtr(aa, ctr, ctrFa = 0.75)
aa |
(numeric) main input |
ctr |
(numeric) 'control' |
ctrFa |
(numeric <1) modulate amplitude of effect |
This function returns an adjusted numeric vector
.bringToCtr(11:14, 9).bringToCtr(11:14, 9)
This function allows checking of argument names
.checkArgNa(x, argNa, lazyEval = TRUE).checkArgNa(x, argNa, lazyEval = TRUE)
x |
(character) main input |
argNa |
(character) argument name |
lazyEval |
(logical) decide if argument should be avaluated with abbreviated names, too |
This function returns a elongated character vector
.checkArgNa("Abc",c("ab","Ab","BCD")).checkArgNa("Abc",c("ab","Ab","BCD"))
This function allows to check list of arrays for consistent dimensions of all arrays
.checkConsistentArrList( arrLst, arrNDim = 3, fxName = NULL, varName = NULL, silent = FALSE, debug = FALSE, callFrom = NULL ).checkConsistentArrList( arrLst, arrNDim = 3, fxName = NULL, varName = NULL, silent = FALSE, debug = FALSE, callFrom = NULL )
arrLst |
(list) main input |
arrNDim |
(integer) number of dimensions for arrays |
fxName |
(character) this name will be given in message |
varName |
(character) |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
list
used in cutArrayInCluLike
.datSlope(c(3:6)).datSlope(c(3:6))
This function allows converting 'dat' (may be list, data.frame etc) to simple vector, more elaborate than unlist()
.checkConvt2Vect(dat, toNumeric = TRUE).checkConvt2Vect(dat, toNumeric = TRUE)
dat |
(list, data.frame) main input |
toNumeric |
(logical) |
This function returns a character (or numeric) vector
unlist; used in equLenNumber
aa <- matrix(11:14, ncol=2) .checkConvt2Vect(aa)aa <- matrix(11:14, ncol=2) .checkConvt2Vect(aa)
This function was designed to check a factor object
.checkFactor( fac, facNa = NULL, minLev = 2, silent = FALSE, debug = FALSE, callFrom = NULL ).checkFactor( fac, facNa = NULL, minLev = 2, silent = FALSE, debug = FALSE, callFrom = NULL )
fac |
(factor) main input |
facNa |
(character) level-names |
minLev |
(integer) minium number of levels |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns a corrceted/adjusted factor
.checkFactor(gl(3,2)).checkFactor(gl(3,2))
Check File Name Extensions Function for checking file-names.
.checkFileNameExtensions(fileNa, ext).checkFileNameExtensions(fileNa, ext)
fileNa |
(character) file name to be checked |
ext |
(character) file extension |
modified character vector
.checkFileNameExtensions("testFile.txt","txt").checkFileNameExtensions("testFile.txt","txt")
This function allows checking an argument for Location of legend, if value provided not found as valid, it returns 'defLoc
.checkLegendLoc( legLoc, defLoc = "topright", silent = FALSE, debug = FALSE, callFrom = NULL ).checkLegendLoc( legLoc, defLoc = "topright", silent = FALSE, debug = FALSE, callFrom = NULL )
legLoc |
(character) main input |
defLoc |
(character) |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns a character vector designing the potential location of legend
.checkLegendLoc("abc").checkLegendLoc("abc")
This function allows to compare 'dat' to confindence interval of linare model 'lMod' (eg from lm())
.checkLmConfInt(dat, lMod, level = 0.95).checkLmConfInt(dat, lMod, level = 0.95)
dat |
matrix or data.frame, main input |
lMod |
linear model, only used to extract coefficients offset & slope |
level |
(numeric) alpha threshold for linear model |
This function returns a logical vector for each value in 2nd col of 'dat' if INSIDE confid interval
set.seed(2016); dat1 <- matrix(c(runif(200)+rep(1:10,20)),ncol=10)set.seed(2016); dat1 <- matrix(c(runif(200)+rep(1:10,20)),ncol=10)
This function allows to check arguments for linear regression. Used as argument checking for regrBy1or2point and regrMultBy1or2point
.checkRegrArguments(inData, refList, regreTo, callFrom = NULL).checkRegrArguments(inData, refList, regreTo, callFrom = NULL)
inData |
(numeric vector) main input |
refList |
(list) |
regreTo |
(numeric vector) |
callFrom |
(character) allow easier tracking of messages produced |
list
.datSlope(c(3:6)).datSlope(c(3:6))
This function allows to do automatic choice of colors: if single-> grey, if few -> RColorBrewer, if many : gradient green -> grey/red
.chooseGrpCol( nGrp, paired = FALSE, alph = 0.2, silent = FALSE, debug = FALSE, callFrom = NULL ).chooseGrpCol( nGrp, paired = FALSE, alph = 0.2, silent = FALSE, debug = FALSE, callFrom = NULL )
nGrp |
(numeric vector) main input |
paired |
(logical) |
alph |
(numeric vector) |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced#' |
This function returns a character vector with color codes
.chooseGrpCol(4).chooseGrpCol(4)
This function allows to combine information (annotation) from list of matrixes (ie replace when NA), using always the columns specified in 'useCol' (numeric)
.combineListAnnot( lst, useCol = 1:2, silent = FALSE, debug = FALSE, callFrom = NULL ).combineListAnnot( lst, useCol = 1:2, silent = FALSE, debug = FALSE, callFrom = NULL )
lst |
(list) main input |
useCol |
(numeric vector) which columns should be used |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns a single matrix of combined (non-redundant) info
used in cutArrayInCluLike
.datSlope(c(3:6)).datSlope(c(3:6))
This function allows to compare by distance/difference
.compareByDiff(dat, limit, distVal = FALSE).compareByDiff(dat, limit, distVal = FALSE)
dat |
list of 2 numerical vectors |
limit |
(numeric, length=1) threshold value for retaining values, used with distace-type specified in argument 'compTy' |
distVal |
(logical) to toggle outpout as matrix of numeric (distance values above 'limit', others NA) or matrix of logical |
This function returns a list with close matches of 'x' to given 'y', the numeric value dependes on 'sortMatch' (if FASLE then always value of 'y' otherwise of longest of x&y)
findCloseMatch, checkSimValueInSer, and also .compareByLogRatio, for convient output countCloseToLimits
cc <- list(aa=11:14, bb=c(13.1,11.5,14.3,20:21))cc <- list(aa=11:14, bb=c(13.1,11.5,14.3,20:21))
This function allows to compare by log-ratio
.compareByLogRatio(dat, limit, distVal = FALSE).compareByLogRatio(dat, limit, distVal = FALSE)
dat |
list of 2 numerical vectors |
limit |
(numeric, length=1) threshold value for retaining values, used with distace-type specified in argument 'compTy' |
distVal |
(logical) to toggle outpout as matrix of numeric (distance values above 'limit', others NA) or matrix of logical |
This function returns a list with close matches of 'x' to given 'y', the numeric value dependes on 'sortMatch' (if FASLE then always value of 'y' otherwise of longest of x&y)
findCloseMatch, checkSimValueInSer, and also .compareByDiff, for convient output countCloseToLimits
cc <- list(aa=11:14, bb=c(13.1,11.5,14.3,20:21)) .compareByLogRatio(cc, 1)cc <- list(aa=11:14, bb=c(13.1,11.5,14.3,20:21)) .compareByLogRatio(cc, 1)
This function allows to compare by ppm
.compareByPPM(dat, limit, distVal = FALSE).compareByPPM(dat, limit, distVal = FALSE)
dat |
list of 2 numerical vectors |
limit |
(numeric, length=1) threshold value for retaining values, used with distace-type specified in argument 'compTy' |
distVal |
(logical) to toggle outpout as matrix of numeric (distance values above 'limit', others NA) or matrix of logical |
This function returns a list with close matches of 'x' to given 'y', the numeric value dependes on 'sortMatch' (if FASLE then always value of 'y' otherwise of longest of x&y)
findCloseMatch, checkSimValueInSer, and also .compareByDiff, for convient output countCloseToLimits
cc <- list(aa=11:14, bb=c(13.1,11.5,14.3,20:21)) .compareByPPM(cc, 1)cc <- list(aa=11:14, bb=c(13.1,11.5,14.3,20:21)) .compareByPPM(cc, 1)
This function was designed to complete the selection of columns of sparse matrix 'dat' with sets of 'nCombin' columns at complete 'coverage' Context : In sparse matrix 'dat' search subsets of columns with some rows as complete (no NA).
.complCols(x, dat, nCombin).complCols(x, dat, nCombin)
x |
(integer, length=1) column number for with other columns to combine & give (some) complete non-NA lines are seeked |
dat |
(matrix) .. init data, smay be parse matrix with numerous NA |
nCombin |
(integer) .. number of columns used to make complete subset |
This function returns a matrix of column-indexes complementing (nCombin rows)
.complCols(3, dat=matrix(c(NA,12:17,NA,19),ncol=3), nCombin=3).complCols(3, dat=matrix(c(NA,12:17,NA,19),ncol=3), nCombin=3)
This function was designed for tracing the hierarchy of function-calls. It allows to remove any tailing space or ': ' from 'callFrom' (character vector) and return with added 'newNa' (+ 'add2Tail')
.composeCallName(newNa, add2Head = "", add2Tail = " : ", callFrom = NULL).composeCallName(newNa, add2Head = "", add2Tail = " : ", callFrom = NULL)
newNa |
(character vector) main input |
add2Head |
(character) |
add2Tail |
(character) |
callFrom |
(character) may also contain multiple separate names (ie length >1), will be concatenated using ' -> ' |
This function returns a character vector (history of who called whom)
.composeCallName("newFunction", callFrom="initFunction").composeCallName("newFunction", callFrom="initFunction")
Take matrix and return vector
.convertMatrToNum(matr, useCol = NULL).convertMatrToNum(matr, useCol = NULL)
matr |
(matrix) main input |
useCol |
(integer) design the comumns to be used |
numeric vector
.convertMatrToNum(matrix(1:6, ncol=2)).convertMatrToNum(matrix(1:6, ncol=2))
This function converts/standardizes names of 'query' to standard names from 'ref' (list of possible names (char vect) where names define standardized name). It takes 'query' as character vector and return character vecor (same length as 'query') with 'converted/corrected' names
.convertNa(query, ref, partMatch = TRUE).convertNa(query, ref, partMatch = TRUE)
query |
(matrix or data.frame, min 2 columns) main input |
ref |
(list) list of multiple possible names associated to given group, reference name for each group is name of list |
partMatch |
(logical) allows partial matching (ie name of 'ref' must be in head of 'query') |
This function returns a character vector
daPa <- matrix(c(1:5,8,2:6,9), ncol=2)daPa <- matrix(c(1:5,8,2:6,9), ncol=2)
This function aims to avoid duplicating items between 'curNa' and 'newNa' by incrementing digits after 'extPref' (in newNa)
.corDuplItemsByIncrem(newNa, curNa, extPref = "_s").corDuplItemsByIncrem(newNa, curNa, extPref = "_s")
newNa |
(character) main input 1 |
curNa |
(character) main input 2 |
extPref |
(character) extension |
This function returns the corrected input vector newNa
.corDuplItemsByIncrem(letters[1:6], letters[8:4]).corDuplItemsByIncrem(letters[1:6], letters[8:4])
This function extracts/cuts text-fragments out of txt following specific anchors defined by arguments cutFrom and cutTo.
.cutAtSearch( x, searchChar, after = TRUE, silent = TRUE, debug = FALSE, callFrom = NULL ).cutAtSearch( x, searchChar, after = TRUE, silent = TRUE, debug = FALSE, callFrom = NULL )
x |
character vector to be treated |
searchChar |
(character) text to look for |
after |
(logical) |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns a modified character vector
.cutAtSearch("abcdefg","de").cutAtSearch("abcdefg","de")
This function allows truncating character vector to all variants from given start, with min and optonal max length Used to evaluate argument calls without giving full length of argument
.cutStr(txt, startFr = 1, minLe = 1, maxLe = NULL, reverse = TRUE).cutStr(txt, startFr = 1, minLe = 1, maxLe = NULL, reverse = TRUE)
txt |
(character) main input, may be length >1 |
startFr |
(interger) where to start |
minLe |
(interger) minimum length of output |
maxLe |
(interger) maximum length of output |
reverse |
(logical) return longest text-fragments at beginning of vector |
This function returns a character vector
.cutStr("abcdefg", minLe=2).cutStr("abcdefg", minLe=2)
This function allows to model a linear regression and optionally to plot the results
.datSlope( dat, typeOfPlot = "sort", toNinX = FALSE, plotData = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL ).datSlope( dat, typeOfPlot = "sort", toNinX = FALSE, plotData = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )
dat |
(vector or matrix) main input |
typeOfPlot |
(character) |
toNinX |
(logical) |
plotData |
(logical) |
silent |
(logical) suppress messages |
debug |
(logical) display additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
numeric vector with intercept and slope, optional plot
.datSlope(c(3:6)).datSlope(c(3:6))
This function allows retreiving extensions to filenames similar to file_ext, but also alllows to retreive selected double-extensions (txt.gz).
The leading dor will ne excluded similar to file_ext
.doubleExt(fiNa, termExt = c("gz", "zip")).doubleExt(fiNa, termExt = c("gz", "zip"))
fiNa |
(character) name of file to be tested (may include path) |
termExt |
(character) additional terminal extensions |
The argument termExt allows specifying additional (terminal) extensions to be recognized.
This function returns a character vector with file-extensions (excluding the leading dot). (Only purely alphanumeric extensions are recognized.)
fi <- c("ab","ab.c","ab.c.gz","ab.d","ab.d.zip","ab.e") .doubleExt(fi)fi <- c("ab","ab.c","ab.c.gz","ab.d","ab.d.zip","ab.e") .doubleExt(fi)
This function allows extracting NA-neighbour value
.extrNAneighb(x, grp).extrNAneighb(x, grp)
x |
initial matrix to treat |
grp |
(factor) grouing of replicates |
This function returns a numeric vector
unique, nonAmbiguousNum, faster than firstOfRepeated which gives more detail in output (lines/elements/indexes of omitted)
.extrNAneighb(c(11:14,NA), rep(1,5)).extrNAneighb(c(11:14,NA), rep(1,5))
This function aims to extract number(s) before capital character
.extrNumHeadingCap(x).extrNumHeadingCap(x)
x |
character vector to be treated |
This function returns a numeric vector
.extrNumHeadingCap(" 1B ").extrNumHeadingCap(" 1B ")
This function aims to extract number(s) before separator followed by alphabetic character (return named numeric vector, NAs when no numeric part found)
.extrNumHeadingSepChar(x, sep = "_").extrNumHeadingSepChar(x, sep = "_")
x |
character vector to be treated |
sep |
(character) separator |
This function returns a numeric vector
.extrNumHeadingSepChar(" 1B ").extrNumHeadingSepChar(" 1B ")
limInt) and add sandwich-nodes (nodes inter-connecting initial nodes) out of node-based queries.Filter nodes & edges for extracting networks (main)
This function allows extracting and filtering network-data based on fixed threshold (limInt) and add sandwich-nodes (nodes inter-connecting initial nodes) out of node-based queries.
.filterNetw( lst, remOrphans = TRUE, reverseCheck = TRUE, filtCol = 2, callFrom = NULL, silent = FALSE, debug = FALSE ).filterNetw( lst, remOrphans = TRUE, reverseCheck = TRUE, filtCol = 2, callFrom = NULL, silent = FALSE, debug = FALSE )
lst |
(list, composed of multiple matrix or data.frames ) main input (each list-element should have same number of columns) |
remOrphans |
(logical) remove networks consisting only of 2 connected edges |
reverseCheck |
(logical) |
filtCol |
(integer, length=1) which column of |
callFrom |
(character) allow easier tracking of message(s) produced |
silent |
(logical) suppress messages |
debug |
(logical) display additional messages for debugging |
This function returns a matrix or data.frame
filterNetw and other CRAN package dedeicated to networks
ab <- 1:10ab <- 1:10
Filtering of matrix or array x (may be 3-dim array) according to fiTy and checkVa
.filterSw(x, fiTy, checkVa, indexRet = TRUE).filterSw(x, fiTy, checkVa, indexRet = TRUE)
x |
array (3-dim) of numeric data |
fiTy |
(character) which type of testing to perform ('eq','inf','infeq','sup','supeq', '>', '<', '>=', '<=', '==') |
checkVa |
(logical) s |
indexRet |
(logical) if |
This function returns either index (position within 'x') or concrete (filtered) result
filt3dimArr; filterList; filterLiColDeList;
arr1 <- array(11:34, dim=c(4,3,2), dimnames=list(c(LETTERS[1:4]), paste("col",1:3,sep=""),c("ch1","ch2"))) filt3dimArr(arr1,displCrit=c("col1","col2"),filtCrit="col2",filtVal=7) .filterSw(arr1, fiTy="inf", checkVa=7)arr1 <- array(11:34, dim=c(4,3,2), dimnames=list(c(LETTERS[1:4]), paste("col",1:3,sep=""),c("ch1","ch2"))) filt3dimArr(arr1,displCrit=c("col1","col2"),filtCrit="col2",filtVal=7) .filterSw(arr1, fiTy="inf", checkVa=7)
This function aims to filter for size
.filtSize(x, minSize = 5, maxSize = 36).filtSize(x, minSize = 5, maxSize = 36)
x |
main inpuy |
minSize |
(integer) minimum number of characters, if |
maxSize |
(integer) maximum number of characters |
This function returns a list of filtered input
filtSizeUniq; correctToUnique, unique, duplicated
aa <- 1:10aa <- 1:10
This function aims to find overlap instances among range of values in lines of 'x' (typically give just min & max)
.findBorderOverlaps(x, rmRedund = FALSE, callFrom = NULL).findBorderOverlaps(x, rmRedund = FALSE, callFrom = NULL)
x |
(matrix of numeric values or all-numeric data.frame) main input |
rmRedund |
(logical) report overlaps only in 1st instance (will show up twice otherwise) |
callFrom |
(character) allow easier tracking of message(s) produced |
This function returns a matrix with line for each overlap found, cols 'refLi' (line no), 'targLi' (line no), 'targCol' (col no)
aa <- 11:15aa <- 11:15
This function allows to find the first minimum of a numeric vector
.firstMin(x, positionOnly = FALSE).firstMin(x, positionOnly = FALSE)
x |
(numeric vector) main input |
positionOnly |
(logical) |
numeric vector
.firstMin(c(4,3:6)).firstMin(c(4,3:6))
This function allows fusing 2 instances of 3dim arr as mult cols in 3dim array (ie fuse along 2nd dim, increase cols)
.fuse2ArrBy2ndDim(arr1, arr2, silent = FALSE, debug = FALSE, callFrom = NULL).fuse2ArrBy2ndDim(arr1, arr2, silent = FALSE, debug = FALSE, callFrom = NULL)
arr1 |
(array) |
arr2 |
(array) |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This functuin returns a numeric vector with numer of non-numeric characters (ie not '.' or 0-9))
aa <- 11:15aa <- 11:15
This function calculates the 'A' value (ie group mean) for each group of replicates (eg for MA-plot)
.getAmean(dat, grp).getAmean(dat, grp)
dat |
(matrix or data.frame) main input |
grp |
(factor) grouping of replicates |
This function returns a numeric vector
.getAmean(matrix(11:18, ncol=4), gl(2,2)).getAmean(matrix(11:18, ncol=4), gl(2,2))
This function calculates the 'A' value (ie group mean) for each group of replicates (eg for MA-plot)
comp is matrix telling which groups to use/compare, assuming that dat are already group-means)
.getAmean2(dat, comp).getAmean2(dat, comp)
dat |
(matrix or data.frame) main input |
comp |
(matrix) tells which groups to use/compare, assuming that dat are already group-means) |
This function returns a numeric vector
.getAmean(matrix(11:18, ncol=4), gl(2,2)).getAmean(matrix(11:18, ncol=4), gl(2,2))
This function calculates the 'M' value (ie log-ratio) for each group of replicates based on comp (eg for MA-plot)
comp is matrix telling which groups to use/compare, assuming that dat are already group-means)
.getMvalue2(dat, comp).getMvalue2(dat, comp)
dat |
(matrix or data.frame) main input |
comp |
(matrix) tells which groups to use/compare, assuming that dat are already group-means) |
This function returns a numeric vector
.getAmean(matrix(11:18, ncol=4), gl(2,2)).getAmean(matrix(11:18, ncol=4), gl(2,2))
Find Separator In Vector Of Pairwise Group-Names
This function allows identifing separator used when pairwise groups are presented.
.getPWseparator( compNames, potSep = "split1", includeGrp = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL ).getPWseparator( compNames, potSep = "split1", includeGrp = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )
compNames |
(character or integer) names of pairwise combined group-names |
potSep |
(character) potential separators to be checked if occuring in |
includeGrp |
(logical) if |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Note : Potential separators potSep to be tested must be at least 1 character long
The character '.' may used as potSep, it will be protected internally for correct results.
Note : The indexing is relative to the levels of grp, thus to sorted group-names !
This function returns a character vector (length=1) of the (first) separator fitting to all data, or a list with $sep and $grpNa if includeGrp=TRUE
indexGroupsFromPW, getPWseparator, colnames of testing results from moderTestXgrp, used by replacePWseparator
.getPWseparator(compNames=c("B-C","B-D","C-D")).getPWseparator(compNames=c("B-C","B-D","C-D"))
This function allows growing tree-like structures (data.tree objects)
.growTree(tm, setX, addToObj = NULL).growTree(tm, setX, addToObj = NULL)
tm |
(list) main input, $disDat .. matrix with integer start & end sites for fragments; $lo (logical) which fragments may be grown; $start (integer) index for which line of $disDat to start; $it numeric version of $lo; $preN for previous tree objects towards root; $iter for iterator (starting at 1)) |
setX |
.. data.tree object (main obj from root) |
addToObj |
.. data.tree object (branch on which to add new branches/nodes) |
This function returns a list
.datSlope(c(3:6)).datSlope(c(3:6))
This function allows aegmenting (1-dim vector) 'dat' into clusters. If 'automClu=TRUE ..' first try automatic clustering, if too few clusters, run km with length(dat)^0.3 clusters This function requires the package NbClust to be installed.
.insp1dimByClustering( dat, automClu = TRUE, cluChar = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL ).insp1dimByClustering( dat, automClu = TRUE, cluChar = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )
dat |
matrix or data.frame, main input |
automClu |
(logical) run atomatic clustering |
cluChar |
(logical) to display cluster characteristics |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns clustering (class index) or (if 'cluChar'=TRUE) list with clustering and cluster-characteristics
set.seed(2016); dat1 <- matrix(c(runif(200)+rep(1:10,20)),ncol=10)set.seed(2016); dat1 <- matrix(c(runif(200)+rep(1:10,20)),ncol=10)
This function inspects 'matr' and check if 1st line can be used/converted as header. If colnames of 'matr' are either NULL or 'V1',etc the 1st row will be tested if it contains any of the elements (if not, 1st line won't be used as new colnames) If 'numericCheck'=TRUE, all columns will be tested if they can be converted to numeric
.inspectHeader( matr, headNames = c("Plate", "Well", "StainA"), numericCheck = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL ).inspectHeader( matr, headNames = c("Plate", "Well", "StainA"), numericCheck = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )
matr |
(matrix or data.frame) main input to be instected |
headNames |
(character) column-names t look for |
numericCheck |
(logical) allows reducing complexity by drawing for very long x or y |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns a matrix vector or data.frame similar to input
head for looking at first few lines
ma1 <- matrix(letters[1:6], ncol=3, dimnames=list(NULL,c("ab","Plate","Well"))) .inspectHeader(ma1)ma1 <- matrix(letters[1:6], ncol=3, dimnames=list(NULL,c("ab","Plate","Well"))) .inspectHeader(ma1)
This function allows to refine/filter 'dat1' (1dim dataset, eg cluster) with aim of keeping center of data. It is done based on most freq class of histogramm keep/filter data if 'core' (
.keepCenter1d( dat1, core = NULL, keepOnly = TRUE, displPlot = FALSE, silent = TRUE, debug = FALSE, callFrom = NULL ).keepCenter1d( dat1, core = NULL, keepOnly = TRUE, displPlot = FALSE, silent = TRUE, debug = FALSE, callFrom = NULL )
dat1 |
simple numeric vector |
core |
numeric vactor (betw 0 and 1) for fraction of data to keep; if null trimmedMean/max hist occurance will be used, limited within 30-70 perent; may also be 'high' or 'low' for forcing low (20-60percent) or high (75-99) percent of data to retain |
keepOnly |
(logical) |
displPlot |
(logical) show plot of hist & boundaries |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns the index of values retained or if 'keepOnly' return list with 'keep' index and 'drop' index
set.seed(2016); dat1 <- matrix(c(runif(200)+rep(1:10,20)),ncol=10)set.seed(2016); dat1 <- matrix(c(runif(200)+rep(1:10,20)),ncol=10)
This function aims to remove all columns where all data are not finite
.keepFiniteCol( dat, msgStart = NULL, silent = FALSE, debug = FALSE, callFrom = NULL ).keepFiniteCol( dat, msgStart = NULL, silent = FALSE, debug = FALSE, callFrom = NULL )
dat |
(matrix or data.frame) main input |
msgStart |
(character) |
silent |
(logical) suppres messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
This function returns a corrected matrix or data.frame
ma1 <- matrix(c(1:5, Inf), ncol=2) .keepFiniteCol(ma1)ma1 <- matrix(c(1:5, Inf), ncol=2) .keepFiniteCol(ma1)
This function allows to checking if a given vector may be numeric content
.mayBeNum(x, pattern = NULL).mayBeNum(x, pattern = NULL)
x |
(numeric vector) main input |
pattern |
(character) custom pattern to check |
This functions returns a logical/boolean vector for each of the elements of 'x'
.mayBeNum(c(3:6)).mayBeNum(c(3:6))
This function allows to rescale data 'x' so that specific group 'grpNum' gets normalized to predefined value 'grpVal'. In normal case x will be multiplied by 'grpVal' and devided by value obtained from 'grpNum'. If summary of 'grpNum-positions' or 'grpVal' is 0, then grpVal will be attained by subtraction of summary & adding grpVal
.medianSpecGrp(x, grpNum, grpVal, sumMeth = "median", callFrom = NULL).medianSpecGrp(x, grpNum, grpVal, sumMeth = "median", callFrom = NULL)
x |
(numeric vector) main input |
grpNum |
(numeric) |
grpVal |
(numeric) |
sumMeth |
(character) method for summarizing |
callFrom |
(character) allow easier tracking of messages produced |
numeric vector
.firstMin(c(4,3:6)).firstMin(c(4,3:6))
This function allows merging of multiple matrix-like objects from an initial list.
.mergeMatrices( inpL, mode = "intersect", useColumn = 1, extrRowNames = FALSE, na.rm = TRUE, argL = NULL, silent = FALSE, debug = FALSE, callFrom = NULL ).mergeMatrices( inpL, mode = "intersect", useColumn = 1, extrRowNames = FALSE, na.rm = TRUE, argL = NULL, silent = FALSE, debug = FALSE, callFrom = NULL )
inpL |
(list containing matrices or data.frames) main input (multiple matrix or data.frame objects) |
mode |
(character) allows choosing restricting to all common elements ( |
useColumn |
(integer, character or list) the column(s) to consider, may be |
extrRowNames |
(logical) decide whether columns with all values different (ie no replicates or max divergency) should be excluded |
na.rm |
(logical) suppress |
argL |
(list of arguments) |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns a matrix containing all selected columns of the input matrices to fuse
mergeMatrixList, merge, mergeMatrices for separate entries
mat1 <- matrix(11:18, ncol=2, dimnames=list(letters[3:6],LETTERS[1:2]))mat1 <- matrix(11:18, ncol=2, dimnames=list(letters[3:6],LETTERS[1:2]))
This function aims to find closest neighbour to numeric vector
.minDif(z, initOrder = TRUE, rat = TRUE).minDif(z, initOrder = TRUE, rat = TRUE)
z |
(numeric) vector to search minimum difference |
initOrder |
(logical) return matrix so that 'x' matches exactely 2nd col of output |
rat |
(logical) express result as ratio |
This function returns a matrix with index,value,dif,best
.minDif(c(11:15,17)).minDif(c(11:15,17))
This function returns distances beteenw sorted points of 2-column matrix 'x'
.neigbDis(x, asSum = TRUE).neigbDis(x, asSum = TRUE)
x |
(matrix or data.frame, min 2 columns) main input |
asSum |
(logical) if |
This function returns a numeric vector with distances
daPa <- matrix(c(1:5,8,2:6,9), ncol=2) .neigbDis(daPa)daPa <- matrix(c(1:5,8,2:6,9), ncol=2) .neigbDis(daPa)
This function aims to normalize a matrix or data.frame by columns. It assumes all checks have been done before calling this function.
.normalize( dat, meth, mode, param, silent = FALSE, debug = FALSE, callFrom = NULL ).normalize( dat, meth, mode, param, silent = FALSE, debug = FALSE, callFrom = NULL )
dat |
matrix or data.frame of data to get normalized |
meth |
(character) may be "mean","median","NULL","none", "standardize","trimMean", "rowNormalize", "slope", "exponent", "twoPointSlope", "vsn"; When |
mode |
(character) may be "proportional", "additive";
decide if normalizatio factors will be applies as multiplicative (proportional) or additive; for log2-omics data |
param |
(list) additional parameters |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
This function returns a numeric vector
aa <- matrix(1:12, ncol=3) .normalize(aa,"median",mode="proportional",param=NULL)aa <- matrix(1:12, ncol=3) .normalize(aa,"median",mode="proportional",param=NULL)
This function aims to normalize columns of 2dim matrix to common linear regression fit within range of 'useQuant'
.normConstSlope( mat, useQuant = c(0.2, 0.8), refLines = NULL, diagPlot = TRUE, plotLog = "", datName = NULL, silent = FALSE, debug = FALSE, callFrom = NULL ).normConstSlope( mat, useQuant = c(0.2, 0.8), refLines = NULL, diagPlot = TRUE, plotLog = "", datName = NULL, silent = FALSE, debug = FALSE, callFrom = NULL )
mat |
matrix or data.frame of data to get normalized |
useQuant |
(numeric) quantiles to use |
refLines |
(NULL or numeric) allows to consider only specific lines of 'dat' when determining normalization factors (all data will be normalized) |
diagPlot |
(logical) draw diagnistic plot |
plotLog |
(character) indicate which axis shousl be diplayed on log-scale, may be 'x', 'xy' or 'y' |
datName |
(character) use as title in diag plot |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
This function returns a numeric vector
aa <- matrix(1:12, ncol=3)aa <- matrix(1:12, ncol=3)
This function allows paste columns
.pasteCols(mat, sep = "").pasteCols(mat, sep = "")
mat |
inital matrix |
sep |
(character) separator |
This function returns a simplified/non-redundant vector/matrix (ie fewer lines for matrix), or respective index
unique, nonAmbiguousNum, faster than firstOfRepeated which gives more detail in output (lines/elements/indexes of omitted)
.pasteCols(matrix(11:16,ncol=2), sep="_").pasteCols(matrix(11:16,ncol=2), sep="_")
This function allows to inspect results of table or uniqCountReport on a pie-plot
Note : fairly slow for long vectors !!
.plotCountPie( count, tit = NULL, col = NULL, radius = 0.9, sizeTo = NULL, clockwise = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL ).plotCountPie( count, tit = NULL, col = NULL, radius = 0.9, sizeTo = NULL, clockwise = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )
count |
(integer vector) counting result |
tit |
(character) optional title in plot |
col |
(character) custom colors in pie |
radius |
(numeric) radius passed to |
sizeTo |
(numeric or charcter) optional reference group for size-population relative adjusting overall surface of pie |
clockwise |
(logical) argument passed to pie |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
vector with counts of n (total), nUnique (wo any repeated), nHasRepeated (first of repeated), nRedundant), optional figure
uniqCountReport, correctToUnique, unique
.plotCountPie(table(c(1:5,4:2))).plotCountPie(table(c(1:5,4:2)))
This function allows adding all content as lower caps to/of character vector
.plusLowerCaps(x).plusLowerCaps(x)
x |
(character) main input |
This function returns a elongated character vector
.plusLowerCaps(c("Abc","BCD")).plusLowerCaps(c("Abc","BCD"))
This function calculates residues of (2-dim) linear model 'lMod'-prediction of/for 'dat' (using 2nd col of 'useCol' ) (indexing in 'dat', matrix or data.frame with min 2 cols), using 1st col of 'useCol' as 'x'. It may be used for comparing/identifying data close to regression (eg re-finding data on autoregression line in FT-ICR)
.predRes(dat, lMod, regTy = "lin", useCol = 1:2).predRes(dat, lMod, regTy = "lin", useCol = 1:2)
dat |
matrix or data.frame, main input |
lMod |
linear model, only used to extract coefficients offset & slope |
regTy |
(character) type of regression model |
useCol |
(integer) columns to use |
This function returns a numeric vector of residues (for each line of dat)
set.seed(2016); dat1 <- matrix(c(runif(200)+rep(1:10,20)),ncol=10)set.seed(2016); dat1 <- matrix(c(runif(200)+rep(1:10,20)),ncol=10)
This function aims to raise all values close to lowest value to end up as at value of 'raiseTo'. This is done independently for each col of mat. This function sets all data to common raiseTo (which is min among all cols)
.raiseColLowest( mat, raiseTo = NULL, minFa = 0.1, silent = FALSE, debug = FALSE, callFrom = NULL ).raiseColLowest( mat, raiseTo = NULL, minFa = 0.1, silent = FALSE, debug = FALSE, callFrom = NULL )
mat |
(matrix of numeric values) main input |
raiseTo |
(numeric) |
minFa |
(numeric) minimum factor |
silent |
(logical) suppress messages |
debug |
(logical) display additional messages for debugging |
callFrom |
(character) allow easier tracking of message(s) produced |
This function returns a numeric vector with numer of non-numeric characters (ie not '.' or 0-9))
aa <- 11:15aa <- 11:15
This function aims to remove columns indicated by col-number
.removeCol(matr, rmCol).removeCol(matr, rmCol)
matr |
(matrix or data.frame) main input |
rmCol |
(integer) column index for removing |
This function returns an matrix or data.frame
aa <- matrix(1:6, ncol=3) .removeCol(aa, 2)aa <- matrix(1:6, ncol=3) .removeCol(aa, 2)
This function aims to search for (empty) columns conaining only entries defined in 'searchFields' and remove such columns. If 'fromBackOnly' =TRUE .. only tailing empty columns will be removed (other columns with "empty" entries in middle will be kept). If ”=TRUE columns containing all NAs will be excluded as well This function will also remove columns containing (exculsively) mixtures of the various 'searchFields'.
.removeEmptyCol( dat, fromBackOnly = TRUE, searchFields = c("", " ", "NA.", NA), silent = FALSE, debug = FALSE, callFrom = NULL ).removeEmptyCol( dat, fromBackOnly = TRUE, searchFields = c("", " ", "NA.", NA), silent = FALSE, debug = FALSE, callFrom = NULL )
dat |
(matrix or data.frame) main input |
fromBackOnly |
(logical) |
searchFields |
(character) |
silent |
(logical) suppres messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
This function returns a corrected matrix or data.frame
ma1 <- matrix(c(1:5, NA), ncol=2) .removeEmptyCol(ma1)ma1 <- matrix(c(1:5, NA), ncol=2) .removeEmptyCol(ma1)
This function allows replacing special characters
Note that (most) special characters must be presented with protection for grep and sub.
.replSpecChar(x, findSp = c("\\(", "\\)", "\\$"), replBy = "_").replSpecChar(x, findSp = c("\\(", "\\)", "\\$"), replBy = "_")
x |
(character) main input |
findSp |
(character) special characters to replace (may have to be given as protected) |
replBy |
(character) replace by |
This function returns a corrceted/adjusted factor
.replSpecChar(c("jhjh(ab)","abc")).replSpecChar(c("jhjh(ab)","abc"))
This functions trims character strings: It keeps only text before 'sep' (length=1 !)
.retain1stPart(chr, sep = " = ", offSet = 1).retain1stPart(chr, sep = " = ", offSet = 1)
chr |
character vector to be treated |
sep |
(character) saparator |
offSet |
(integer) off-set |
This function returns a modified character vector
.retain1stPart("abc = def").retain1stPart("abc = def")
This function calculates CVs for matrix with multiple groups of data, ie one CV for each group of data.
.rowGrpCV(x, grp, means).rowGrpCV(x, grp, means)
x |
numeric matrix where relplicates are organized into separate columns |
grp |
(factor) defining which columns should be grouped (considered as replicates) |
means |
(numeric) alternative values instead of means by .rowGrpMeans() |
This function returns a matrix of CV values
rowGrpCV, rowCVs, arrayCV, replPlateCV
set.seed(2016); dat1 <- matrix(c(runif(200)+rep(1:10,20)),ncol=10) grp1 <- gl(4,3,labels=LETTERS[1:4])[2:11] head(.rowGrpCV(dat1, grp1, .rowGrpMeans(dat1, grp1)))set.seed(2016); dat1 <- matrix(c(runif(200)+rep(1:10,20)),ncol=10) grp1 <- gl(4,3,labels=LETTERS[1:4])[2:11] head(.rowGrpCV(dat1, grp1, .rowGrpMeans(dat1, grp1)))
This function calculates CVs for matrix with multiple groups of data, ie one CV for each group of data.
.rowGrpMeans(x, grp, na.replVa = NULL, na.rm = TRUE).rowGrpMeans(x, grp, na.replVa = NULL, na.rm = TRUE)
x |
numeric matrix where relplicates are organized into separate columns |
grp |
(factor) defining which columns should be grouped (considered as replicates) |
na.replVa |
(numeric) value to replace |
na.rm |
(logical) remove all |
This function returns a matrix of mean values per row and group of replicates
rowGrpCV, rowCVs, arrayCV, replPlateCV
set.seed(2016); dat1 <- matrix(c(runif(200)+rep(1:10,20)),ncol=10) grp1 <- gl(4,3,labels=LETTERS[1:4])[2:11] head(.rowGrpMeans(dat1, grp1))set.seed(2016); dat1 <- matrix(c(runif(200)+rep(1:10,20)),ncol=10) grp1 <- gl(4,3,labels=LETTERS[1:4])[2:11] head(.rowGrpMeans(dat1, grp1))
This function calculates sd for matrix with multiple groups of data, ie one sd for each group of data.
.rowGrpSds(x, grp).rowGrpSds(x, grp)
x |
numeric matrix where relplicates are organized into separate columns |
grp |
(factor) defining which columns should be grouped (considered as replicates) |
This function returns a matrix of sd values per row and group of replicates
rowGrpCV, rowCVs, arrayCV, replPlateCV
set.seed(2016); dat1 <- matrix(c(runif(200)+rep(1:10,20)),ncol=10) grp1 <- gl(4,3,labels=LETTERS[1:4])[2:11] head(.rowGrpSds(dat1, grp1))set.seed(2016); dat1 <- matrix(c(runif(200)+rep(1:10,20)),ncol=10) grp1 <- gl(4,3,labels=LETTERS[1:4])[2:11] head(.rowGrpSds(dat1, grp1))
This function calculates row-sums for matrix with multiple groups of data, with multiple groups of data, ie one sd for each group of data.
.rowGrpSums(x, grp, na.replVa = NULL, na.rm = TRUE).rowGrpSums(x, grp, na.replVa = NULL, na.rm = TRUE)
x |
numeric matrix where relplicates are organized into separate columns |
grp |
(factor) defining which columns should be grouped (considered as replicates) |
na.replVa |
(numeric) value to replace |
na.rm |
(logical) remove all |
This function returns a matrix of row-sums for matrix with multiple groups of data
rowGrpCV, rowCVs, arrayCV, replPlateCV
set.seed(2016); dat1 <- matrix(c(runif(200)+rep(1:10,20)),ncol=10) grp1 <- gl(4,3,labels=LETTERS[1:4])[2:11] head(.rowGrpSums(dat1, grp1))set.seed(2016); dat1 <- matrix(c(runif(200)+rep(1:10,20)),ncol=10) grp1 <- gl(4,3,labels=LETTERS[1:4])[2:11] head(.rowGrpSums(dat1, grp1))
This function performs a row-normalization procedure on matrix or data.frame 'dat'
.rowNorm( dat, refLi, method, proportMode, maxFact = 10, fact0val = 10, retFact = FALSE, debug = FALSE, silent = FALSE, callFrom = NULL ).rowNorm( dat, refLi, method, proportMode, maxFact = 10, fact0val = 10, retFact = FALSE, debug = FALSE, silent = FALSE, callFrom = NULL )
dat |
(matrix) .. init data, smay be parse matrix with numerous NA |
refLi |
(NULL or numeric) allows to consider only specific lines of 'dat' when determining normalization factors (all data will be normalized) |
method |
(character) may be "mean","median" (plus "NULL","none"); When NULL or 'none' is chosen the input will be returned as is |
proportMode |
(logical) decide if normalization should be done by multiplicative or additive factor |
maxFact |
(numeric, length=2) max normalization factor |
fact0val |
(integer) |
retFact |
(logical) |
debug |
(logical) additional messages for debugging |
silent |
(logical) suppress messages |
callFrom |
(character) This function allows easier tracking of messages produced |
This function returns a matrix of normalized data same dimensions as 'dat'
.rowNorm(matrix(11:31, ncol=3), refLi=1, method="mean", proportMode=TRUE).rowNorm(matrix(11:31, ncol=3), refLi=1, method="mean", proportMode=TRUE)
This function was designed to obtain normalization factors.
.rowNormFact( dat, combOfN, comUse, method = "median", refLi = NULL, refGrp = NULL, proportMode = TRUE, minQuant = NULL, maxFact = 10, omitNonAlignable = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL ).rowNormFact( dat, combOfN, comUse, method = "median", refLi = NULL, refGrp = NULL, proportMode = TRUE, minQuant = NULL, maxFact = 10, omitNonAlignable = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )
dat |
(matrix) .. init data, smay be parse matrix with numerous NA |
combOfN |
(matrix) .. # matrix of index for all sub-groups (assumed as sorted) |
comUse |
(list) .. index of complete lines for each col of combOfN |
method |
(character) may be "mean","median" (plus "NULL","none"); When NULL or 'none' is chosen the input will be returned as is |
refLi |
(NULL or numeric) allows to consider only specific lines of 'dat' when determining normalization factors (all data will be normalized) |
refGrp |
(integer) Only the columns indicated will be used as reference, default all columns (integer or colnames) |
proportMode |
(logical) decide if normalization should be done by multiplicative or additive factor |
minQuant |
(numeric) optional filter to set all values below given value as |
maxFact |
(numeric, length=2) max normalization factor |
omitNonAlignable |
(logical) allow omitting all columns which can't get aligned due to sparseness |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) This function allows easier tracking of messages produced |
This function returns a matrix of column-indexes complementing (nCombin rows)
ma1 <- matrix(11:41, ncol=3)ma1 <- matrix(11:41, ncol=3)
This function rescales between 0 and 1
.scale01(x).scale01(x)
x |
numeric vector to be re-scaled |
This function returns a numeric vector of same length with re-scaled values
.scale01(11:15).scale01(11:15)
This function allows to rescale data 'x' so that 2 specific groups get normalized to predefined values (and all other values follow proportionally) 'grp1Num' and 'grp2Num' should be either numeric for positions in 'x' or character for names of 'x'; if 'grp1Num' and/or 'grp2Num' design mulitple locations: perform median or mean summarization, according to 'sumMeth'
.scaleSpecGrp( x, grp1Num, grp1Val, grp2Num = NULL, grp2Val = NULL, sumMeth = "mean", callFrom = NULL ).scaleSpecGrp( x, grp1Num, grp1Val, grp2Num = NULL, grp2Val = NULL, sumMeth = "mean", callFrom = NULL )
x |
(numeric vector) main input |
grp1Num |
(numeric) |
grp1Val |
(numeric) |
grp2Num |
(numeric) |
grp2Val |
(numeric) |
sumMeth |
(character) method for summarizing |
callFrom |
(character) allow easier tracking of messages produced |
numeric vector
.firstMin(c(4,3:6)).firstMin(c(4,3:6))
This function rescales between user-defined min and max values
.scaleXY(x, minim = 2, maxim = 3).scaleXY(x, minim = 2, maxim = 3)
x |
numeric vector to be re-scaled |
minim |
(numeric) minimum value for resultant vactor |
maxim |
(numeric) minimum value for resultant vactor |
This function returns a matrix of CV values
.scaleXY(11:15, min=1, max=100).scaleXY(11:15, min=1, max=100)
This function is depreciated, please use /cutStr instead !
This function allows truncating character vector to all variants from given start, with min and optonal max length
Used to evaluate argument calls without giving full length of argument
.seqCutStr(txt, startFr = 1, minLe = 1, reverse = TRUE).seqCutStr(txt, startFr = 1, minLe = 1, reverse = TRUE)
txt |
(character) main input, may be length >1 |
startFr |
(interger) where to start |
minLe |
(interger) minimum length of output |
reverse |
(logical) return longest text-fragments at beginning of vector |
This function returns a character vector
.seqCutStr("abcdefg", minLe=2).seqCutStr("abcdefg", minLe=2)
This function aims to set lowest value of x to value 'setTo'
.setLowestTo(x, setTo).setLowestTo(x, setTo)
x |
(numeric) main vector to be treated |
setTo |
(numeric) replacement value |
This function returns a numeric vector
.setLowestTo(9:4, 6).setLowestTo(9:4, 6)
This function chooses the (first) most frequent or middle of sorted vector, similar to the concept of mode
.sortMid(x, retVal = TRUE).sortMid(x, retVal = TRUE)
x |
(numeric) main input |
retVal |
(logical) return value of most frequent, if |
This function returns a numeric verctor
simple/partial functionality in summarizeCols, checkSimValueInSer
.sortMid(11:14) .sortMid(rep("b",3)).sortMid(11:14) .sortMid(rep("b",3))
This function aims to reorganize an array by reducing dimension 'byDim' (similar to stack() for data-frames) It returns an array/matrix of 1 dimension less than 'arr', 1st dim has more lines (names as paste with '_')
.stackArray(arr, byDim = 3).stackArray(arr, byDim = 3)
arr |
(array) main input |
byDim |
(integer) |
This function returns an array/matrix of 1 dimension less than 'arr', 1st dim has more lines (names as paste with '_')
(arr1 <- array(11:37, dim=c(3,3,3))) .stackArray(arr1, 3)(arr1 <- array(11:37, dim=c(3,3,3))) .stackArray(arr1, 3)
This function summarizes columns of matrix (or data.frame) 'x' using apply In case of character entries the 'median' of sorted values will be returned
.summarizeCols( x, me = "median", nEq = FALSE, vectAs1row = TRUE, supl = NULL, silent = FALSE, debug = FALSE, callFrom = NULL ).summarizeCols( x, me = "median", nEq = FALSE, vectAs1row = TRUE, supl = NULL, silent = FALSE, debug = FALSE, callFrom = NULL )
x |
data.frame matrix of data to be summarized by comlumn |
me |
(character, length=1) summarization method (eg 'min','max','mean','mean.trim','median','sd','CV', 'medianComplete' or 'meanComplete' etc, see |
nEq |
(logical) if TRUE, add additional column indicating the number of equal lines for choice (only with min or max) |
vectAs1row |
(logical) if TRUE will interprete non-matrix 'x' as matrix with 1 row (correct effect of automatic conversion when extracting 1 line) |
supl |
(numeric) supplemental parameters for the various summarizing functions (currently used with 'me=mean.trim' to assign upper and lower trimming fraction, passed to ) |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
vector with summary for each column (unless 'me=="summary"', in this case a matrix or list will be returned )
m1 <- matrix(c(28,27,11,12,11,12), nrow=2, dimnames=list(1:2,c("y","x","ref"))) .summarizeCols(m1, me="median")m1 <- matrix(c(28,27,11,12,11,12), nrow=2, dimnames=list(1:2,c("y","x","ref"))) .summarizeCols(m1, me="median")
Deprecated Version - This function allows trimming/removing redundant text-fragments from end
.trimFromEnd(x, ..., callFrom = NULL, debug = FALSE, silent = TRUE).trimFromEnd(x, ..., callFrom = NULL, debug = FALSE, silent = TRUE)
x |
character vector to be treated |
... |
more vectors to be treated |
callFrom |
(character) allow easier tracking of messages produced |
debug |
(logical) display additional messages for debugging |
silent |
(logical) suppress messages |
This function returns a modified character vector
trimRedundText; Inverse : Find/keep common text keepCommonText; you may also look for related functions in package stringr
txt1 <- c("abcd_ccc","bcd_ccc","cde_ccc") .trimRight(txt1)txt1 <- c("abcd_ccc","bcd_ccc","cde_ccc") .trimRight(txt1)
Deprecated Version - This function allows trimming/removing redundant text-fragments from start
.trimFromStart( x, ..., minNchar = 1, silent = TRUE, debug = FALSE, callFrom = NULL ).trimFromStart( x, ..., minNchar = 1, silent = TRUE, debug = FALSE, callFrom = NULL )
x |
character vector to be treated |
... |
more vectors to be treated |
minNchar |
(integer) minumin number of characters that must remain |
silent |
(logical) suppress messages |
debug |
(logical) display additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns a modified character vector
trimRedundText; Inverse : Find/keep common text keepCommonText; you may also look for related functions in package stringr
txt1 <- c("abcd_ccc","bcd_ccc","cde_ccc") .trimLeft(txt1) # replacementtxt1 <- c("abcd_ccc","bcd_ccc","cde_ccc") .trimLeft(txt1) # replacement
This function allows trimming/removing redundant text-fragments from left side.
.trimLeft(x, minNchar = 1, silent = TRUE, debug = FALSE, callFrom = NULL).trimLeft(x, minNchar = 1, silent = TRUE, debug = FALSE, callFrom = NULL)
x |
character vector to be treated |
minNchar |
(integer) minumin number of characters that must remain |
silent |
(logical) suppress messages |
debug |
(logical) display additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns a modified character vector
trimRedundText; Inverse : Find/keep common text keepCommonText; you may also look for related functions in package stringr
txt1 <- c("abcd_ccc","bcd_ccc","cde_ccc") .trimLeft(txt1)txt1 <- c("abcd_ccc","bcd_ccc","cde_ccc") .trimLeft(txt1)
This function allows trimming/removing redundant text-fragments from right side.
.trimRight(x, minNchar = 1, silent = TRUE, debug = FALSE, callFrom = NULL).trimRight(x, minNchar = 1, silent = TRUE, debug = FALSE, callFrom = NULL)
x |
character vector to be treated |
minNchar |
(integer) minumin number of characters that must remain |
silent |
(logical) suppress messages |
debug |
(logical) display additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns a modified character vector
trimRedundText; Inverse : Find/keep common text keepCommonText; you may also look for related functions in package stringr
txt1 <- c("abcd_ccc","bcd_ccc","cde_ccc") .trimRight(txt1)txt1 <- c("abcd_ccc","bcd_ccc","cde_ccc") .trimRight(txt1)
This function is an enhanced version of unique, names of elements are maintained
.uniqueWName( x, splitSameName = TRUE, silent = TRUE, debug = FALSE, callFrom = NULL ).uniqueWName( x, splitSameName = TRUE, silent = TRUE, debug = FALSE, callFrom = NULL )
x |
(numeric or character vector) main input |
splitSameName |
(logical) |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
vector like input
aa <- c(a=11, b=12,a=11,d=14, c=11) .uniqueWName(aa) .uniqueWName(aa[-1]) # value repeated but different nameaa <- c(a=11, b=12,a=11,d=14, c=11) .uniqueWName(aa) .uniqueWName(aa[-1]) # value repeated but different name
Take (numeric) vector and return matrix, if 'colNa' given will be used as colname
.vector2Matr(x, colNa = NULL, rowsKeep = TRUE).vector2Matr(x, colNa = NULL, rowsKeep = TRUE)
x |
(numeric or character) main input |
colNa |
(integer) design the comumn-name to be given |
rowsKeep |
(logical) is |
matrix
.vector2Matr(c(3:6)).vector2Matr(c(3:6))
This function helps changing character strings like file-names and allows adding the character vector 'add' (length 1) before the extension (defined by last '.') of the input string 'x'. Used for easily creating variants/additional filenames but keeping current extension.
addBeforeFileExtension( x, add, sep = "_", silent = FALSE, callFrom = NULL, debug = FALSE )addBeforeFileExtension( x, add, sep = "_", silent = FALSE, callFrom = NULL, debug = FALSE )
x |
main character vector of file-names |
add |
character vector to be added |
sep |
(character) separator between 'x' & 'add' (character, length 1) |
silent |
(logical) suppress messages |
callFrom |
(character) allow easier tracking of messages produced |
debug |
(logical) additional messages for debugging |
Since this function replaces the deprecated addBeforFileExtension (to correct a typo in the name of the old version of the function).
modified character vector
addBeforeFileExtension(c("abd.txt","ghg.ijij.txt","kjh"),"new")addBeforeFileExtension(c("abd.txt","ghg.ijij.txt","kjh"),"new")
This function helps changing character strings like file-names and allows adding the character vector 'add' (length 1) before the extension (defined by last '.') of the input string 'x'. Used for easily creating variants/additional filenames but keeping current extension.
addBeforFileExtension( x, add, sep = "_", silent = FALSE, callFrom = NULL, debug = FALSE )addBeforFileExtension( x, add, sep = "_", silent = FALSE, callFrom = NULL, debug = FALSE )
x |
main character vector of file-names |
add |
character vector to be added |
sep |
(character) separator between 'x' & 'add' (character, length 1) |
silent |
(logical) suppress messages |
callFrom |
(character) allow easier tracking of messages produced |
debug |
(logical) additional messages for debugging |
This function will get deprecated and is replaced by addBeforeFileExtension (to correct a typo in the name of this function).
modified character vector
addBeforFileExtension(c("abd.txt","ghg.ijij.txt","kjh"), "new")addBeforFileExtension(c("abd.txt","ghg.ijij.txt","kjh"), "new")
This function performs linear rescaling of numeric data based on specified limits (ie a specified window). Values are adjusted to fit within a target range defined by 'regrTo'.
adjBy2ptReg( dat, lims, regrTo = c(0.1, 0.9), refLines = NULL, silent = FALSE, debug = FALSE, callFrom = NULL )adjBy2ptReg( dat, lims, regrTo = c(0.1, 0.9), refLines = NULL, silent = FALSE, debug = FALSE, callFrom = NULL )
dat |
A numeric vector or matrix of values to adjust. |
lims |
A list of two numeric vectors, each of length 1 or 2, representing the lower and upper limits for rescaling. Example: 'lims = list(c(5, 9), c(60, 90))'. |
regrTo |
A numeric vector of length 2 defining the target range for rescaling (default: 'c(0.1, 0.9)'). |
refLines |
Optional numeric or character vector specifying reference lines (rows) in 'dat' to use for rescaling. If 'NULL', all rows are used. |
silent |
Logical. If 'TRUE', suppresses messages (default: 'FALSE'). |
debug |
Logical. If 'TRUE', prints debugging messages (default: 'FALSE'). |
callFrom |
Character string for tracking messages (default: 'NULL'). |
Since this function shares sigificant overlap with scaleXY (which has more advanced options) it is rather suggested to use _scaleXY()_ instead.
The function _adjBy2ptReg()_ will may deprecated in the future.
A numeric vector or matrix with adjusted values.
set.seed(2016); dat1 <- round(runif(50, 0, 100), 1) adjBy2ptReg(dat1, lims = list(c(5, 9), c(60, 90))) plot(dat1, adjBy2ptReg(dat1, lims=list(c(5,9), c(60,90))))set.seed(2016); dat1 <- round(runif(50, 0, 100), 1) adjBy2ptReg(dat1, lims = list(c(5, 9), c(60, 90))) plot(dat1, adjBy2ptReg(dat1, lims=list(c(5,9), c(60,90))))
This function provides help converting values with with different unit-prefixes to a single prefix-unit type. This can be used to convert a vector of mixed prefixes like 'p' and 'n'. Any text to the right of the unit will be ignored.
adjustUnitPrefix( x, pref = c("z", "a", "f", "p", "n", "u", "m", "", "k", "M", "G"), unit = "sec", sep = c("_", ".", " ", ""), minTrimNChar = 0, returnType = c("NAifInvalid", "allText"), silent = FALSE, debug = FALSE, callFrom = NULL )adjustUnitPrefix( x, pref = c("z", "a", "f", "p", "n", "u", "m", "", "k", "M", "G"), unit = "sec", sep = c("_", ".", " ", ""), minTrimNChar = 0, returnType = c("NAifInvalid", "allText"), silent = FALSE, debug = FALSE, callFrom = NULL )
x |
(character) vector containing digit uunit-prefix and unit terms |
pref |
(character) multiplicative unit-prefixes, assumes as increasing factors of 1000 |
unit |
(character) unit name, the numeric part may be sepatated by one space-character |
sep |
(character) separator characters that may appear between integer numeric value and unit description |
minTrimNChar |
(integer) min number of text characters when trimming adjacent text on left and right of main numeric+prefix+unit |
returnType |
(character) set options for retuning results : 'NAifInvalid' .. return NA for invalid parts,'allText' .. return initial text if problem, 'trim' |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
The aim of this function if to allow adjusting a vector containing '100pMol' and '1nMol' to '100pMol' and '1000pMol' for better downstream analysis.
Please note that the current version recognizes and converts only interger values; decimals or scientific writing won't be recognized properly.
The resultant numeric vector expresses all values as lowest prefix unit level.
In case of invalid entries NAs will be returned.
Please note that decimal/comma digits will not be recognized properly, since the function will consider (by default) the decimal sign as just another separator.
To avoid special characters (which may not work on all operating-systems) the letter 'u' is used for 'micro'.
This function returns a character vector (same length as input) with adjusted unified decimal prefix and adjusted numeric content, the numeric content only is also giben in the names of the output
convToNum; checkUnitPrefix; trimRedundText
adjustUnitPrefix(c("2.psec abc","20 fsec etc"), unit="sec") x1 <- c("50_amol", "5_fmol","250_amol","100_amol", NA, "500_amol", "500_amol", "1_fmol") adjustUnitPrefix(x1, unit="mol") x2 <- c("abCc 500_nmol ABC", "abEe5_umol", "", "abFF_100_nmol_G", "abGg 2_mol", "abH.1 mmol") rbind( adjustUnitPrefix(x2, unit="mol", returnType="allText") , adjustUnitPrefix(x2, unit="mol", returnType="trim"), adjustUnitPrefix(x2, unit="mol", returnType=""))adjustUnitPrefix(c("2.psec abc","20 fsec etc"), unit="sec") x1 <- c("50_amol", "5_fmol","250_amol","100_amol", NA, "500_amol", "500_amol", "1_fmol") adjustUnitPrefix(x1, unit="mol") x2 <- c("abCc 500_nmol ABC", "abEe5_umol", "", "abFF_100_nmol_G", "abGg 2_mol", "abH.1 mmol") rbind( adjustUnitPrefix(x2, unit="mol", returnType="allText") , adjustUnitPrefix(x2, unit="mol", returnType="trim"), adjustUnitPrefix(x2, unit="mol", returnType=""))
This function allows combining two vectors or lists without duplicating common content (definded by name of list-elements).
appendNR( x, y, rmDuplicate = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )appendNR( x, y, rmDuplicate = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )
x |
(vector or list) must have names to allow checking for duplicate names in y |
y |
(vector or list) must have names to allow checking for duplicate names in x |
rmDuplicate |
(logical) avoid duplicating liste-elements present in both x and y (based on names of list-elements) |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of message(s) produced |
When setting the argument rmDuplicate=FALSE the function will behave like append.
If both x and y are vectors, the output will be a vector, otherwise it will be a list
li1 <- list(a=1, b=2, c=3) li2 <- list(A=11, B=12, c=3) appendNR(li1, li2) append(li1, li2)li1 <- list(a=1, b=2, c=3) li2 <- list(A=11, B=12, c=3) appendNR(li1, li2) append(li1, li2)
arrayCV gets CVs for replicates in 2 or 3 dim array and returns CVs as matrix.
This function may be used to calculate CVs from replicate microtiter plates (eg 8x12) where replicates are typically done as multiple plates,
ie initial matrixes that are the organized into arrays.
arrayCV(arr, byDim = 3, silent = TRUE, callFrom = NULL)arrayCV(arr, byDim = 3, silent = TRUE, callFrom = NULL)
arr |
(3-dim) array of numeric data like where replicates are along one dimesion of the array |
byDim |
(integer) over which dimension repliates are found |
silent |
(logical) suppres messages |
callFrom |
(character) allow easier tracking of message produced |
matrix of CV values
set.seed(2016); dat1 <- matrix(c(runif(200) +rep(1:10,20)), ncol=10) head(arrayCV(dat1,byDim=2))set.seed(2016); dat1 <- matrix(c(runif(200) +rep(1:10,20)), ncol=10) head(arrayCV(dat1,byDim=2))
asSepList allows reorganizing most types of input into a list with separate numeric vectors. For example, matrixes or data.frames will be split into separate columns
(differnt to partUnlist which maintains the original structure). This function also works with lists of lists.
This function may be helpful for reorganizing data for plots.
asSepList( y, minLen = 4, asNumeric = TRUE, exclElem = NULL, sep = "_", fillNames = TRUE, silent = FALSE, callFrom = NULL, debug = FALSE )asSepList( y, minLen = 4, asNumeric = TRUE, exclElem = NULL, sep = "_", fillNames = TRUE, silent = FALSE, callFrom = NULL, debug = FALSE )
y |
list to be separated/split in vectors |
minLen |
(integer) min length (or number of rows), as add'l element to eliminate arguments given without names when asSepList is called in vioplot2 |
asNumeric |
(logical) to transform all list-elements in simple numeric vectors (won't work if some entries are character) |
exclElem |
(character) optinal names to exclude if any (lazy matching) matches (to exclude other arguments be misinterpreted as data) |
sep |
(character) separator when combining name of list-element to colames |
fillNames |
(logical) add names for list-elements/ series when not given |
silent |
(logical) suppress messages |
callFrom |
(character) allow easier tracking of messages produced |
debug |
(logical) display additional messages for debugging |
This function returns a list, partially unlisted to vectors
bb <- list(fa=gl(2,2), c=31:33, L2=matrix(21:28,nc=2), li=list(li1=11:14, li2=data.frame(41:44))) asSepList(bb) ## multi data-frame examples ca <- data.frame(a=11:15, b=21:25, c=31:35) cb <- data.frame(a=51:53, b=61:63) cc <- list(gl(3,2), ca, cb, 91:94, short=81:82, letters[1:5]) asSepList(cc) cd <- list(e1=gl(3,2), e2=ca, e3=cb, e4=91:94, short=81:82, e6=letters[1:5]) asSepList(cd)bb <- list(fa=gl(2,2), c=31:33, L2=matrix(21:28,nc=2), li=list(li1=11:14, li2=data.frame(41:44))) asSepList(bb) ## multi data-frame examples ca <- data.frame(a=11:15, b=21:25, c=31:35) cb <- data.frame(a=51:53, b=61:63) cc <- list(gl(3,2), ca, cb, 91:94, short=81:82, letters[1:5]) asSepList(cc) cd <- list(e1=gl(3,2), e2=ca, e3=cb, e4=91:94, short=81:82, e6=letters[1:5]) asSepList(cd)
This function provides for normalizing 2 entire data-sets against each other while preserving each set's characteristics. Several methods are possible: normalize blocks to common range, blocks to common median, to common distribution per block (quantile-normalization)
blockNormalize( x, y, z = NULL, method = "quantile.block", range = c(0, 1), q = c(0, 1), silent = FALSE, debug = FALSE, callFrom = NULL )blockNormalize( x, y, z = NULL, method = "quantile.block", range = c(0, 1), q = c(0, 1), silent = FALSE, debug = FALSE, callFrom = NULL )
x |
(matrix or data.frame) first data-set (must be at least 2 columns and 3 lines) |
y |
(matrix or data.frame) second data-set (must be at least 2 columns and 3 lines) |
z |
( |
method |
Character string or function specifying the normalization method: - '"quantile.block"' (default): Aligns the distributions of all input datasets to a **common target distribution** (the mean of sorted values at each quantile). After normalization, 'sort(x)', 'sort(y)', and 'sort(z)' (if provided) are **identical**. This is useful for making datasets directly comparable. - '"rescale"': Rescales each dataset **independently** to the range specified by 'range'. Preserves the shape of each distribution but standardizes the scale (e.g., to '[0, 1]'). - '"median"': This precedure works in a proportional matter. It centers each dataset by deviding by its group median and multiplying by the overall median. This removes location differences while preserving spread. - '"logMedian"': This precedure is adoped for log-data. It centers each dataset by subtracting its group-median and addding the overall median. Removes location differences while preserving spread. - '"none"': No normalization |
range |
(numeric vector, length=2) vector specifying the target values to be used in case |
q |
(numeric vector, length=2) vector specifying the quantiles to be used in case |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Main methods for choice :
- quantile.block: This method runs a quantile-normalization on each block (but NOT on each column). Thus, all datasets will get the same (overall) distributions.
- rescale: Apply a linear transformation to each dataset to fit within given 'range'.
- median: Normalize each block to get the same overall median (individual columns may deviate, the original order is preserved).
- logMedian: This procedure is an median normalization adopted to log-data. Instead of dividing and multiplying per-group medians will be subtracted and the target median will be added.
- none: Besides, it is also possible to not do any normalization, the output will be identical to the input
NA Handling:
For all approaches NAs will get ignored.
With method='quantile.block' all precise positions where there is an NA in any of the data x, y or z will be ignored to
maintain equal numbers of data.
This is due to the fact that regular quantile-normalization requires equal numbers of data per column
(here one dataset is treated like a column in regular normalization).
This means that the dataset with the highest number of NAs will indirectly has the capacity
to mask valid data in other data-sets.
This function returns a list of the normalized sets for x and y (and z if given)
normalizeThis for normalizing all columns of single data-set, quantile, scale for standard scaling
## Basic usage with vectors x <- c(1, 5, 3, 7, 2) y <- c(10, 20, 30, 40, 50) ## Align distributions (default: x and y will have identical distributions) norm1 <- blockNormalize(x, y) table(sort(norm1$x) == sort(norm1$y)) # all TRUE with 'quantile.block' ## matrix-example (like with omics-data) set.seed(2026); mat1 <- matrix(rnorm(70), nrow=10) *5 # 10 lines x 10 samples set.seed(2025); mat2 <- matrix(rnorm(70, mean=5), nrow=10)^2 -15 mat2[which(mat2 < 1.8)] <- mat2[which(mat2 < 1.8)] + 32 norm2 <- blockNormalize(mat1, mat2, method="rescale", range=c(0.1, 10)) sapply(norm2, range) norm3 <- blockNormalize(mat1, mat2, method="median") sapply(norm3, quantile, c(0.25,0.5,0.75), na.rm=TRUE) norm4 <- blockNormalize(mat1, mat2, method="quantile.block") sapply(norm4, quantile, c(0.25,0.5,0.75), na.rm=TRUE) ## the resulting distribution layout(matrix(1:4, ncol=2)) boxplot(cbind(mat1, NA, mat2), main="initial", las=1) boxplot(cbind(norm2$x, NA, norm2$y), main="rescale block", las=1) boxplot(cbind(norm3$x, NA, norm3$y), main="median block", las=1) boxplot(cbind(norm4$x, NA, norm4$y), main="quantile.block", las=1) ## the overall distribution of blocks layout(matrix(1:4, ncol=2)) boxplot(cbind(mat1=as.numeric(mat1), mat2=as.numeric(mat2)), main="initial (overall)",las=1) boxplot(cbind(mat1=as.numeric(norm2$x), mat2=as.numeric(norm2$x)), main="rescale block norm (overall)",las=1) boxplot(cbind(mat1=as.numeric(norm3$x), mat2=as.numeric(norm3$x)), main="median block norm (overall)",las=1) boxplot(cbind(mat1=as.numeric(norm4$x), mat2=as.numeric(norm4$x)), main="quantile.block norm (overall)",las=1)## Basic usage with vectors x <- c(1, 5, 3, 7, 2) y <- c(10, 20, 30, 40, 50) ## Align distributions (default: x and y will have identical distributions) norm1 <- blockNormalize(x, y) table(sort(norm1$x) == sort(norm1$y)) # all TRUE with 'quantile.block' ## matrix-example (like with omics-data) set.seed(2026); mat1 <- matrix(rnorm(70), nrow=10) *5 # 10 lines x 10 samples set.seed(2025); mat2 <- matrix(rnorm(70, mean=5), nrow=10)^2 -15 mat2[which(mat2 < 1.8)] <- mat2[which(mat2 < 1.8)] + 32 norm2 <- blockNormalize(mat1, mat2, method="rescale", range=c(0.1, 10)) sapply(norm2, range) norm3 <- blockNormalize(mat1, mat2, method="median") sapply(norm3, quantile, c(0.25,0.5,0.75), na.rm=TRUE) norm4 <- blockNormalize(mat1, mat2, method="quantile.block") sapply(norm4, quantile, c(0.25,0.5,0.75), na.rm=TRUE) ## the resulting distribution layout(matrix(1:4, ncol=2)) boxplot(cbind(mat1, NA, mat2), main="initial", las=1) boxplot(cbind(norm2$x, NA, norm2$y), main="rescale block", las=1) boxplot(cbind(norm3$x, NA, norm3$y), main="median block", las=1) boxplot(cbind(norm4$x, NA, norm4$y), main="quantile.block", las=1) ## the overall distribution of blocks layout(matrix(1:4, ncol=2)) boxplot(cbind(mat1=as.numeric(mat1), mat2=as.numeric(mat2)), main="initial (overall)",las=1) boxplot(cbind(mat1=as.numeric(norm2$x), mat2=as.numeric(norm2$x)), main="rescale block norm (overall)",las=1) boxplot(cbind(mat1=as.numeric(norm3$x), mat2=as.numeric(norm3$x)), main="median block norm (overall)",las=1) boxplot(cbind(mat1=as.numeric(norm4$x), mat2=as.numeric(norm4$x)), main="quantile.block norm (overall)",las=1)
It is assumed that multiple fragments from a common ancestor bay be charcterized by the their start- and end-sites by integer values.
For example, If 'abcdefg' is the ancestor, the fragments 'bcd' (from position 2 to 4) to and 'efg' may then be assembled.
To do so, all fragments must be presented as matix specifying all start- and end-sites (and fragment-names).
buildTree searchs contiguous fragments from columns 'posCo' (start/end) from 'disDat' to build tree & extract path information starting with line 'startFr'.
Made for telling if dissociated fragments contribute to long assemblies.
This function uses various functions of package data.tree which must be installed, too.
buildTree( disDat, startFr = NULL, posCo = c("beg", "end"), silent = FALSE, debug = FALSE, callFrom = NULL )buildTree( disDat, startFr = NULL, posCo = c("beg", "end"), silent = FALSE, debug = FALSE, callFrom = NULL )
disDat |
(matrix or data.frame) integer values with 1st column, ie start site of fragment, 2nd column as end of fragments, rownames as unique IDs (node-names) |
startFr |
(integer) index for 1st node (typically =1 if 'disDat' sorted by "beg"), should point to a terminal node for consective growing of branches |
posCo |
(character) colnames specifying the begin & start sites in 'disDat', if NULL 1st & 2nd col will be used |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns a list with $paths (branches as matrix with columns 'sumLen' & 'n'), $usedNodes (character vector of all names used to build tree) and $tree (object from data.tree)
package data.tree original function used Node; in this package : for exploiting edge/tree related issues simpleFragFig, countSameStartEnd and contribToContigPerFrag,
frag2 <- cbind(beg=c(2,3,7,13,13,15,7,9,7,3,7,5,7,3),end=c(6,12,8,18,20,20,19,12,12,4,12,7,12,4)) rownames(frag2) <- c("A","E","B","C","D","F","H","G","I", "J","K","L","M","N") buildTree(frag2) countSameStartEnd(frag2)frag2 <- cbind(beg=c(2,3,7,13,13,15,7,9,7,3,7,5,7,3),end=c(6,12,8,18,20,20,19,12,12,4,12,7,12,4)) rownames(frag2) <- c("A","E","B","C","D","F","H","G","I", "J","K","L","M","N") buildTree(frag2) countSameStartEnd(frag2)
cbindNR combines all matrixes given as arguments to non-redundant column names (by ADDING the number of 'duplicated' columns !).
Thus, this function works similar to cbind, but allows combining multiple matrix-objects containing redundant column-names.
Of course, all input-matrixes must have the same number of rows !
By default, the output gets sorted by column-names.
Note, due to the use of '...' arguments must be given by their full argument-names, lazy evaluation might not recognize properly argument names.
cbindNR( ..., convertDFtoMatr = TRUE, sortOutput = TRUE, summarizeAs = "sum", silent = FALSE, debug = FALSE, callFrom = NULL )cbindNR( ..., convertDFtoMatr = TRUE, sortOutput = TRUE, summarizeAs = "sum", silent = FALSE, debug = FALSE, callFrom = NULL )
... |
all matrixes to get combined in cbind way |
convertDFtoMatr |
(logical) decide if output should be converted to matrix |
sortOutput |
(logical) optional sorting by column-names |
summarizeAs |
(character) decide of combined values should get summed (default, 'sum') or averaged ('mean') |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns a matrix or data.frame (as cbind would return)
cbind, nonAmbiguousNum, firstOfRepLines
ma1 <- matrix(1:6, ncol=3, dimnames=list(1:2,LETTERS[3:1])) ma2 <- matrix(11:16, ncol=3, dimnames=list(1:2,LETTERS[3:5])) cbindNR(ma1, ma2) cbindNR(ma1, ma2, summarizeAs="mean")ma1 <- matrix(1:6, ncol=3, dimnames=list(1:2,LETTERS[3:1])) ma2 <- matrix(11:16, ncol=3, dimnames=list(1:2,LETTERS[3:5])) cbindNR(ma1, ma2) cbindNR(ma1, ma2, summarizeAs="mean")
This function compares if/how neighbour groups separate/overlap via the 'engineering approach' (+/- 2 standard-deviations is similar to a=0.05 t.test).
This approach may be used as less elegant alternative to (multi-group) logistic regression.
The function uses 'daAv' as matrix of means (rows are tested for up/down character/progression) which get compared with boundaries taken from daSd (for Sd values of each mean in 'daAv').
checkAvSd( daAv, daSd, nByGr = NULL, multSd = 2, codeConst = "const", extSearch = FALSE, outAsLogical = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )checkAvSd( daAv, daSd, nByGr = NULL, multSd = 2, codeConst = "const", extSearch = FALSE, outAsLogical = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )
daAv |
matrix or data.frame |
daSd |
matrix or data.frame |
nByGr |
optinal specifying number of Elements per group, allows rather using SEM (adopt to variable n of different groups) |
multSd |
(numeric) the factor specifyin how many sd values should be used as margin |
codeConst |
(character) which term/word to use when specifying 'constant' |
extSearch |
(logical) if TRUE, extend search to one group further (will call result 'nearUp' or 'nearDw') |
outAsLogical |
to switch between 2col-output (separate col for 'up' and 'down') or simple categorical vector ('const','okDw','okUp') |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
The function returns a character-vector describing as 'const' or 'okUp','okDw' (or if extSearch=TRUE 'nearUp','nearDw')
mat1 <- matrix(rep(11:24,3)[1:40], byrow=TRUE,ncol=8) checkGrpOrderSEM(mat1, grp=gl(3,3)[-1]) checkAvSd(rowGrpMeans(mat1,gl(3,3)[-1]), rowGrpSds(mat1, gl(3,3)[-1]) ) # consider variable n : checkAvSd(rowGrpMeans(mat1,gl(3,3)[-1]),rowGrpSds(mat1,gl(3,3)[-1]),nByGr=c(2,3,3))mat1 <- matrix(rep(11:24,3)[1:40], byrow=TRUE,ncol=8) checkGrpOrderSEM(mat1, grp=gl(3,3)[-1]) checkAvSd(rowGrpMeans(mat1,gl(3,3)[-1]), rowGrpSds(mat1, gl(3,3)[-1]) ) # consider variable n : checkAvSd(rowGrpMeans(mat1,gl(3,3)[-1]),rowGrpSds(mat1,gl(3,3)[-1]),nByGr=c(2,3,3))
This function allows tesing if a given file-name corresponds to an existing file (eg for reading lateron). Indications to the path and file-extensions may be given separately. If no files do match .gz compressed versions may be searched, too.
checkFilePath( fileName = NULL, path = "./", expectExt = "", mode = "compressedOption", compressedOption = NULL, strictExtension = NULL, stopIfNothing = NULL, silent = FALSE, debug = FALSE, callFrom = NULL )checkFilePath( fileName = NULL, path = "./", expectExt = "", mode = "compressedOption", compressedOption = NULL, strictExtension = NULL, stopIfNothing = NULL, silent = FALSE, debug = FALSE, callFrom = NULL )
fileName |
(character) name of file to be tested; may also include an absolute or relative path;
if |
path |
(character, length=1) optional separate entry for path of |
expectExt |
(character) file extension (will not be considered if |
mode |
(character) further details if function should give error or warning if no files found
integrates previous argument |
compressedOption |
deprected (logical) also look for .gz compressed files |
strictExtension |
deprected (logical) decide if extesion ( |
stopIfNothing |
deprected, please use argument |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
When the filename given by the user exists but it's file-extension is not matching expectExt
the argument strictExtension allows to decide if the filename will still be returned or not.
When expectExt is given, initial search will look for perfect matches.
However, if nothing is found and strictExtension=FALSE, a more relaxed and non-case-sensitive search will be performed.
This function returns a character vector with verified file-name(s) (and path), returns NULL if nothing found - unless mode="stopIfNothing"
(RhomeFi <- list.files(R.home())) file.exists(file.path(R.home(), "bin")) checkFilePath(c("xxx","unins000"), R.home(), expectExt="dat")(RhomeFi <- list.files(R.home())) file.exists(file.path(R.home(), "bin")) checkFilePath(c("xxx","unins000"), R.home(), expectExt="dat")
This function tests each line of 'x' if expected order appears. Used for comparing groups of measures with expected profile (simply by mataching expected order)
checkGrpOrder( x, rankExp = NULL, revRank = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )checkGrpOrder( x, rankExp = NULL, revRank = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )
x |
matrix or data.frame, main input |
rankExp |
(numeric) expected order for values in columns, default 'rankExp' =1:ncol(x) |
revRank |
(logical) if 'revRank'=TRUE, the initial ranks & reversed ranks will be tested |
silent |
(logical) suppress messages |
debug |
(logical) display additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns a vector of logical values
set.seed(2005); mat1 <- rbind(matrix(round(runif(40),1),nc=4), rep(1,4)) checkGrpOrder(mat1) checkGrpOrder(mat1,c(1,4,3,2))set.seed(2005); mat1 <- rbind(matrix(round(runif(40),1),nc=4), rep(1,4)) checkGrpOrder(mat1) checkGrpOrder(mat1,c(1,4,3,2))
This function tests each line of 'x' if expected order of (replicate-) groups (defined in 'grp') appears intact, while inluding SEM of groups (replicates) via a proportional weight 'sdFact' as (avGr1-gr1SEM) < (avGr1+gr1SEM) < (avGr2-gr2SEM) < (avGr2+gr2SEM).
checkGrpOrderSEM( x, grp, sdFact = 1, revRank = TRUE, shrink1sampSd = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )checkGrpOrderSEM( x, grp, sdFact = 1, revRank = TRUE, shrink1sampSd = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )
x |
matrix or data.frame |
grp |
(factor) to organize replicate columns of (x) |
sdFact |
(numeric) is proportional factor how many times the SD will be used for defining lower & upper bounds of each group (ie |
revRank |
(logical) (not implemented yet : optionally revert rank) |
shrink1sampSd |
(logical) |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function may be used for comparing groups of measures with expected profiles (by matching expected order) to check if data in 'x' represt ascending groups ('grp') . Groups of size=1: The sd (and SEM) can't be estimated directly without any replicates, however, an estimate can be given by shrinking if 'shrink1sampSd'=TRUE under the hypothesis that the overall mechanisms determining the variances is constant across all samples.
This function returns a list with $rankExp as logical vector telling if group-ranges are asending and $lims wityh the sd-based group-limits
takes only 10
mat1 <- matrix(rep(11:24,3)[1:40], byrow=TRUE, ncol=8) dimnames(mat1) <- list(letters[1:nrow(mat1)], paste(rep(LETTERS[3:1], each=3)[-1], rep(1:3, 3)[-1], sep=".")) checkGrpOrderSEM(mat1, grp=gl(3,3, labels=LETTERS[3:1])[-1])mat1 <- matrix(rep(11:24,3)[1:40], byrow=TRUE, ncol=8) dimnames(mat1) <- list(letters[1:nrow(mat1)], paste(rep(LETTERS[3:1], each=3)[-1], rep(1:3, 3)[-1], sep=".")) checkGrpOrderSEM(mat1, grp=gl(3,3, labels=LETTERS[3:1])[-1])
This function checks all values of 'x' for similar neighbour values within (relative) range of 'ppm' (ie parts per milion as measure of distance).
By default values will be sorted internally, so if a given value of x has anywhere in x another value close enough, this will be detected.
However, if sortX=FALSE only the values next to left and right will be considered.
Return logical vector : FALSE for each entry of 'x' if value inside of ppm range to neighbour (of sorted values)
checkSimValueInSer( x, ppm = 5, sortX = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )checkSimValueInSer( x, ppm = 5, sortX = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )
x |
numeric vector |
ppm |
(numeric, length=1) ppm-range for considering as similar |
sortX |
(logical) allows speeding up function when set to FALSE, for large data that are already sorted |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns a logical vector : TRUE for each entry of x where at least one neighbour is inside of ppm distance/range
similar with more options withinRefRange
va1 <- c(4:7,7,7,7,7,8:10)+(1:11)/28600; checkSimValueInSer(va1) data.frame(va=sort(va1),simil=checkSimValueInSer(va1))va1 <- c(4:7,7,7,7,7,8:10)+(1:11)/28600; checkSimValueInSer(va1) data.frame(va=sort(va1),simil=checkSimValueInSer(va1))
checkStrictOrder tests lines of 'dat' (matrix of data.frame) for strict order (ascending, descending or constant),
each col of data is tested relative to the col on its left.
checkStrictOrder( dat, invertCount = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )checkStrictOrder( dat, invertCount = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )
dat |
matrix or data.frame |
invertCount |
(logical) inverse counting (ie return 0 for all elememts in order) |
silent |
(logical) suppress messages |
debug |
(logical) display additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
matrix with counts of up pairs, down pairs, equal-pairs, if 'invertCount'=TRUE all non-events are counted, ie a resulting 0 means that all columns are following the described characteristics (with variabale col-numbers easier to count)
set.seed(2005); mat1 <- rbind(matrix(round(runif(40),1),nc=4), rep(1,4)) checkStrictOrder(mat1); mat1[which(checkStrictOrder(mat1)[,2]==0),]set.seed(2005); mat1 <- rbind(matrix(round(runif(40),1),nc=4), rep(1,4)) checkStrictOrder(mat1); mat1[which(checkStrictOrder(mat1)[,2]==0),]
This function aims to find a unit abbreviation or name occurring in all elements of a character-vector x.
The unit name may be preceeded by different decimal prefixes (eg 'k','M'), as defined by argument pref and separators (sep).
The unit name will be returned (or first of multiple).
checkUnitPrefix( x, pref = c("a", "f", "p", "n", "u", "m", "", "k", "M", "G", "T", "P"), unit = c("m", "s", "sec", "Mol", "mol", "g", "K", "cd", "A", "W", "Watt", "V", "Volt"), sep = c("", " ", ";", ",", "_", "."), sep2 = "", stringentSearch = FALSE, na.rm = FALSE, protSpecChar = TRUE, inclPat = FALSE, callFrom = NULL, silent = FALSE, debug = FALSE )checkUnitPrefix( x, pref = c("a", "f", "p", "n", "u", "m", "", "k", "M", "G", "T", "P"), unit = c("m", "s", "sec", "Mol", "mol", "g", "K", "cd", "A", "W", "Watt", "V", "Volt"), sep = c("", " ", ";", ",", "_", "."), sep2 = "", stringentSearch = FALSE, na.rm = FALSE, protSpecChar = TRUE, inclPat = FALSE, callFrom = NULL, silent = FALSE, debug = FALSE )
x |
(character) vector containing digit uunit-prefix and unit terms |
pref |
(character) multiplicative unit-prefixes, assumes as increasing factors of 1000 |
unit |
(character) unit name, the numeric part may be sepatated by one space-character |
sep |
(character) separator character(s) that may appear between integer numeric value and unit-prefix |
sep2 |
(character) separator character(s) after |
stringentSearch |
(logical) if |
na.rm |
(logical) remove |
protSpecChar |
(logical) protect special characters and use as they are instead of regex-meaning |
inclPat |
(logical) return list including pattern of successful search |
callFrom |
(character) allow easier tracking of messages produced |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
Basically this function searches the pattern : digit + separator(sep) + prefix(pref) + unit + optional separator2(sep2)
and returns the first unit-name/abbreviation found in all elements of x.
If if()
In case of invalid entries or no common unit-names NULL will be returned.
Please note the 'u' is used for 'micro' since handeling of special characters may not be portal between different operating systems.
This function returns a charcter vector (length=1) with the common unit name, if inclPat=TRUE it returns a list with $unit and $pattern
x1 <- c("10fg WW","xx 10fg 3pW"," 1pg 2.0W") checkUnitPrefix(x1) ## different separators between digit and prefix: x2 <- c("10fg WW","xx 8_fg 3pW"," 1 pg-2.0W") checkUnitPrefix(x2, stringentSearch=TRUE) checkUnitPrefix(x2, stringentSearch=FALSE) x4 <- c("CT_mixture_QY_50_amol_CN_UPS1_CV_Standards_Research_Group", "CT_mixture_QY_5_fmol_CN_UPS1_CV_Standards_Research_Group")x1 <- c("10fg WW","xx 10fg 3pW"," 1pg 2.0W") checkUnitPrefix(x1) ## different separators between digit and prefix: x2 <- c("10fg WW","xx 8_fg 3pW"," 1 pg-2.0W") checkUnitPrefix(x2, stringentSearch=TRUE) checkUnitPrefix(x2, stringentSearch=FALSE) x4 <- c("CT_mixture_QY_50_amol_CN_UPS1_CV_Standards_Research_Group", "CT_mixture_QY_5_fmol_CN_UPS1_CV_Standards_Research_Group")
checkVectLength checks argument 'x' for expected length 'expeL' and return either message or error when expectation not met.
May be used for parameter ('sanity') checking in other user front-end functions.
checkVectLength( x, expeL = 1, stopOnProblem = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )checkVectLength( x, expeL = 1, stopOnProblem = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )
x |
(numeric or charcter vector) input to check length |
expeL |
(numeric) expected length |
stopOnProblem |
(logical) continue on problems with message or stop (as error message) |
silent |
(logical) suppress messages |
debug |
(logical) display additional messages for debugging |
callFrom |
(character) allow easier tracking of message(s) produced |
This function returns NULL; it produces either error-message if length is not OK or optional message if length is OK
aa <- 1:5; checkVectLength(aa,exp=3)aa <- 1:5; checkVectLength(aa,exp=3)
This function looks at all comumns of mat which columns may be likely choices for sample-names and derives then group-names after stripping terminal enumerators.
Ideal sample-names should contain some replicates indicates as terminal enumerators.
chooseGroupNames( mat, useCoNa = NULL, method = "median", sep = c("_", "-", " ", ".", "=", ";"), rmTxt = NULL, asUnique = TRUE, partEnumerator = FALSE, fullReport = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )chooseGroupNames( mat, useCoNa = NULL, method = "median", sep = c("_", "-", " ", ".", "=", ";"), rmTxt = NULL, asUnique = TRUE, partEnumerator = FALSE, fullReport = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )
mat |
(matrix or data.frame) contains possible choices for sample-names |
useCoNa |
(character) optional custom choice for columns of |
method |
(character) decide how to choose number of groups as : min, low, med, high, max or mode
Note arguments |
sep |
(character) separators considered when searching and removing common words |
rmTxt |
(character, length=1) optional removing of custom text (eg variable file-extensions); no obligation that |
asUnique |
(logical) requires all (potential) samples-names to be unique (ie no repeats) to be considered for group-names; also removes all candidate columns with all different names |
partEnumerator |
(logical) when |
fullReport |
(logical) if |
silent |
(logical) suppress messages if |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
The basic idea is that the column containing (good) samples-names contains all different entries and that by stripping terminal enumerators one can understand the grouping of replicates.
Note arguments asUnique and partEnumerator influence which columns of mat will be evaluated/checked
This function returns a character vector with grouop-names (and sample-names as names of entries) or
if fullReport=TRUE a list with $group, $sampleNames, $col (index of column from mat and name of column
rmSharedWords, replicateStructure, protectSpecChar
mat <- cbind(a=letters[1:6], b=paste(rep(c("b","B"), each=3), 1:3), c=rep(1,6), d=gl(3,2), e=rep(c("e","E"),3), f=paste(rep(c("F","f","ff"), each=2), 1:2)) chooseGroupNames(mat, method="median") # col 2 (b/B) chooseGroupNames(mat, method="median", fullReport=TRUE) chooseGroupNames(mat, method="min") # col 2 (b/B) chooseGroupNames(mat, method="max") # col 6 (F/f/ff) chooseGroupNames(mat, method="max", asUnique=FALSE) # col 1 (a..)mat <- cbind(a=letters[1:6], b=paste(rep(c("b","B"), each=3), 1:3), c=rep(1,6), d=gl(3,2), e=rep(c("e","E"),3), f=paste(rep(c("F","f","ff"), each=2), 1:2)) chooseGroupNames(mat, method="median") # col 2 (b/B) chooseGroupNames(mat, method="median", fullReport=TRUE) chooseGroupNames(mat, method="min") # col 2 (b/B) chooseGroupNames(mat, method="max") # col 6 (F/f/ff) chooseGroupNames(mat, method="max", asUnique=FALSE) # col 1 (a..)
This procedures aims to streighten (clean) the most extreme values of noisy replicates by identifying the most distant points (among a set of replicates). The input 'x' (matrix or data.frame) is supposed to come from multiple different measures taken in replicates (eg weight of different individuals as rows taken as multiple replicate measures in subsequent columns).
cleanReplicates( x, centrMeth = "median", nOutl = 2, retOffPos = FALSE, silent = FALSE, callFrom = NULL )cleanReplicates( x, centrMeth = "median", nOutl = 2, retOffPos = FALSE, silent = FALSE, callFrom = NULL )
x |
matrix (or data.frame) |
centrMeth |
(character) method to summarize (mean or median) |
nOutl |
(integer) determines how many points per line will be set to |
retOffPos |
(logical) if |
silent |
(logical) suppres messages |
callFrom |
(character) allow easier tracking of messages produced |
With the argument nOutl the user chooses the total number of most extreme values to replace by NA.
how many of the most extreme replicates of the whole dataset will replaced by NA, ie with nOutl=1
only the single most extreme outlyer will be replaced by NA.
Outlier points are determined as point(s) with highest distance to (row) center (median and mean choice via argument 'centrMeth').
Thus function returns input data with "removed" points set to NA, or if retOffPos=TRUE the most extreme/outlier positions.
This function returns a matrix of same dimensions as input x, data-points which were tagged/removed are set to NA, or if retOffPos=TRUE the most extreme/outlier positions
mat3 <- matrix(c(19,20,30, 18,19,28, 16,14,35),ncol=3) cleanReplicates(mat3, nOutl=1)mat3 <- matrix(c(19,20,30, 18,19,28, 16,14,35),ncol=3) cleanReplicates(mat3, nOutl=1)
This function reorganizes/refines results from simple search of similar values of 2 sets of data by findCloseMatch (as list for one-to many relations) to more human friendly/readable matrix.
This function returns results combining two sets of data which were initially compared (eg measured and threoretical values) as matrix-view using output of findCloseMatch and both original datastes
closeMatchMatrix( closeMatch, predMatr, measMatr, prefMatch = c("^x", "^y"), colPred = 1, colMeas = 1, limitToBest = TRUE, asDataFrame = FALSE, origNa = TRUE, silent = FALSE, callFrom = NULL, debug = FALSE )closeMatchMatrix( closeMatch, predMatr, measMatr, prefMatch = c("^x", "^y"), colPred = 1, colMeas = 1, limitToBest = TRUE, asDataFrame = FALSE, origNa = TRUE, silent = FALSE, callFrom = NULL, debug = FALSE )
closeMatch |
(list) output from |
predMatr |
(vector or matrix) predicted values, the column 'colPred' indicates which column is used for matching from |
measMatr |
(vector or matrix) measured values, the column 'colMeas' indicates which column is used for matching from |
prefMatch |
(character, length=2) prefixes ('^x' and/or '^y') thay may have been added by |
colPred |
(integer or text, length=1) column of 'predMatr' with main values of comparison |
colMeas |
(integer or text, length=1) column of 'measMatr' with main measures of comparison |
limitToBest |
(integer) column of 'measMatr' with main measures of comparison |
asDataFrame |
(logical) convert results to data.frame if non-numeric matrix produced (may slightly slow down big results) |
origNa |
(logical) will try to use original names of objects 'predMatr','measMatr', if they are not multi-column and not conflicting other output-names (otherwise 'predMatr','measMatr' will appear) |
silent |
(logical) suppress messages |
callFrom |
(character) allows easier tracking of messages produced |
debug |
(logical) for bug-tracking: more/enhanced messages |
Additional information (covariables, annotation, ...) may be included as optional columns for either 'predMatr' or 'measMatr'.
Note : It is important to run findCloseMatch with sortMatch=FALSE !
Note : Results presented based on view of 'predMatr', so if multiple 'measMatr' are at within tolared distance, lines of 'measMatr' will be repeated;
Note : Distances 'disToMeas' and 'ppmToPred' are oriented : neg value if measured is lower than predicted (and pos values if higher than predicted);
Note : Returns NULL when nothing within given limits of comparison;
This function returns results as matrix-view based on initial results from findCloseMatch, including optional columns of suppelemental data for both sets of data for comparison. Returns NULL when nothing within limits
findCloseMatch, checkSimValueInSer
aA <- c(11:17); bB <- c(12.001,13.999); cC <- c(16.2,8,9,12.5,15.9,13.5,15.7,14.1,5) (cloMa <- findCloseMatch(aA,cC,com="diff",lim=0.5,sor=FALSE)) # all matches (of 2d arg) to/within limit for each of 1st arg ('x'); 'y' ..to 2nd arg = cC (maAa <- closeMatchMatrix(cloMa,aA,cC,lim=TRUE)) # (maAa <- closeMatchMatrix(cloMa,aA,cC,lim=FALSE,origN=TRUE)) # (maAa <- closeMatchMatrix(cloMa,cbind(valA=81:87,aA),cbind(valC=91:99,cC),colM=2, colP=2,lim=FALSE)) (maAa <- closeMatchMatrix(cloMa,cbind(aA,valA=81:87),cC,lim=FALSE,deb=TRUE)) # a2 <- aA; names(a2) <- letters[1:length(a2)]; c2 <- cC; names(c2) <- letters[10+1:length(c2)] (cloM2 <- findCloseMatch(x=a2,y=c2,com="diff",lim=0.5,sor=FALSE)) (maA2 <- closeMatchMatrix(cloM2,predM=cbind(valA=81:87,a2),measM=cbind(valC=91:99,c2), colM=2,colP=2,lim=FALSE,asData=TRUE)) (maA2 <- closeMatchMatrix(cloM2,cbind(id=names(a2),valA=81:87,a2),cbind(id=names(c2), valC=91:99,c2),colM=3,colP=3,lim=FALSE,deb=FALSE))aA <- c(11:17); bB <- c(12.001,13.999); cC <- c(16.2,8,9,12.5,15.9,13.5,15.7,14.1,5) (cloMa <- findCloseMatch(aA,cC,com="diff",lim=0.5,sor=FALSE)) # all matches (of 2d arg) to/within limit for each of 1st arg ('x'); 'y' ..to 2nd arg = cC (maAa <- closeMatchMatrix(cloMa,aA,cC,lim=TRUE)) # (maAa <- closeMatchMatrix(cloMa,aA,cC,lim=FALSE,origN=TRUE)) # (maAa <- closeMatchMatrix(cloMa,cbind(valA=81:87,aA),cbind(valC=91:99,cC),colM=2, colP=2,lim=FALSE)) (maAa <- closeMatchMatrix(cloMa,cbind(aA,valA=81:87),cC,lim=FALSE,deb=TRUE)) # a2 <- aA; names(a2) <- letters[1:length(a2)]; c2 <- cC; names(c2) <- letters[10+1:length(c2)] (cloM2 <- findCloseMatch(x=a2,y=c2,com="diff",lim=0.5,sor=FALSE)) (maA2 <- closeMatchMatrix(cloM2,predM=cbind(valA=81:87,a2),measM=cbind(valC=91:99,c2), colM=2,colP=2,lim=FALSE,asData=TRUE)) (maA2 <- closeMatchMatrix(cloM2,cbind(id=names(a2),valA=81:87,a2),cbind(id=names(c2), valC=91:99,c2),colM=3,colP=3,lim=FALSE,deb=FALSE))
Run coin-flipping like permutation tests (to compare difference of 2 means: 'x1' and 'x2') without any distribution-assumptions. This function uses the package coin, if not installed, the function will return NULL and give a warning.
coinPermTest( x1, x2, orient = "two.sided", nPerm = 5000, silent = FALSE, debug = FALSE, callFrom = NULL )coinPermTest( x1, x2, orient = "two.sided", nPerm = 5000, silent = FALSE, debug = FALSE, callFrom = NULL )
x1 |
numeric vector (to be compared with vector 'x2') |
x2 |
numeric vector (to be compared with vector 'x1') |
orient |
(character) may be "two.sided","greater" or "less" |
nPerm |
(integer) number of permutations |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns an object of "MCp" class numeric output with p-values
oneway_test in LocationTests
coinPermTest(2, 3, nPerm=200)coinPermTest(2, 3, nPerm=200)
This function returns CV for values in each column (using speed optimized standard deviation). Note : NaN values get replaced by NA.
colCVs(dat, autoconvert = NULL, silent = FALSE, debug = FALSE, callFrom = NULL)colCVs(dat, autoconvert = NULL, silent = FALSE, debug = FALSE, callFrom = NULL)
dat |
(numeric) matix |
autoconvert |
(NULL or character) allows converting simple vectors in matrix of 1 row (autoconvert="row") |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
This function returns a (numeric) vector with CVs for each column of 'dat'
rowSums, rowCVs, rowGrpCV, colSds
set.seed(2016); dat1 <- matrix(c(runif(200) +rep(1:10,20)),ncol=10) head(colCVs(dat1))set.seed(2016); dat1 <- matrix(c(runif(200) +rep(1:10,20)),ncol=10) head(colCVs(dat1))
Determine standard error (sd) of median by bootstraping for multiple sets of data (rows in input matrix 'dat'). Note: The package boot must be installed from CRAN.
colMedSds(dat, nBoot = 99, silent = FALSE, debug = FALSE, callFrom = NULL)colMedSds(dat, nBoot = 99, silent = FALSE, debug = FALSE, callFrom = NULL)
dat |
(numeric) matix |
nBoot |
(integer, length=1) number if iterations |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns a (numeric) vector with estimated standard errors
set.seed(2016); dat1 <- matrix(c(runif(200) +rep(1:10,20)), ncol=10) colMedSds(dat1)set.seed(2016); dat1 <- matrix(c(runif(200) +rep(1:10,20)), ncol=10) colMedSds(dat1)
This function helps making color-gradients for plotting a numerical variable. Note : RColorBrewer palettes were not integrated here/yet.
colorAccording2( x, gradTy = "rainbow", nStartOmit = NULL, nEndOmit = NULL, revCol = FALSE, alpha = 1, silent = FALSE, debug = FALSE, callFrom = NULL )colorAccording2( x, gradTy = "rainbow", nStartOmit = NULL, nEndOmit = NULL, revCol = FALSE, alpha = 1, silent = FALSE, debug = FALSE, callFrom = NULL )
x |
(character) color input |
gradTy |
(character) type of gradeint may be 'rainbow', 'heat.colors', 'terrain.colors', 'topo.colors', 'cm.colors', 'hcl.colors', 'grey.colors', 'gray.colorsW' or 'logGray' |
nStartOmit |
(integer) omit n steps from begining of gradient range |
nEndOmit |
(integer or "sep") omit n steps from end of gradient range, if |
revCol |
(logical) reverse order |
alpha |
(numeric) optional transparency value (1 for no transparency, 0 for complete opaqueness) |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns a character vector (of same length as x) with color encoding
set.seed(2015); dat1 <- round(runif(15),2) plot(1:15,dat1,pch=16,cex=2,col=colorAccording2(dat1)) plot(1:15,dat1,pch=16,cex=2,col=colorAccording2(dat1,nStartO=0,nEndO=4,revCol=TRUE)) plot(1:9,pch=3) points(1:9,1:9,col=transpGraySca(st=0,en=0.8,nSt=9,trans=0.3),cex=42,pch=16)set.seed(2015); dat1 <- round(runif(15),2) plot(1:15,dat1,pch=16,cex=2,col=colorAccording2(dat1)) plot(1:15,dat1,pch=16,cex=2,col=colorAccording2(dat1,nStartO=0,nEndO=4,revCol=TRUE)) plot(1:9,pch=3) points(1:9,1:9,col=transpGraySca(st=0,en=0.8,nSt=9,trans=0.3),cex=42,pch=16)
This function is speed optimized sd per column of a matrix or data.frame and treats each column as independent set of data for sd (equiv to apply(dat,2,sd)).
NAs are ignored from data. Speed improvements may be seen at more than 100 columns
colSds(dat, silent = FALSE, debug = FALSE, callFrom = NULL)colSds(dat, silent = FALSE, debug = FALSE, callFrom = NULL)
dat |
matrix (or data.frame) with numeric values (may contain NAs which will be ignored) |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
numeric vector of sd values
set.seed(2016); dat1 <- matrix(c(runif(200) +rep(1:10,20)), ncol=10) colSds(dat1)set.seed(2016); dat1 <- matrix(c(runif(200) +rep(1:10,20)), ncol=10) colSds(dat1)
This function provides all combinations for each of n elements of vector 'nMax' (positive integer, eg number of max multiplicative value). For example, imagine, we have 3 cities and the (maximum) voting participants per city. Results must be read vertically and allow to see all total possible compositons.
combinatIntTable( nMax, include0 = TRUE, asList = FALSE, callFrom = NULL, debug = FALSE, silent = TRUE )combinatIntTable( nMax, include0 = TRUE, asList = FALSE, callFrom = NULL, debug = FALSE, silent = TRUE )
nMax |
(positive integer) could be max number of voting participants form different cities, eg Paris max 2 persons, Lyon max 1 person ... |
include0 |
(logical) include 0 occurances, ie provide al combinations starting from 0 or from 1 up to nMax |
asList |
(logical) return result as list or as array |
callFrom |
(character) allow easier tracking of messages produced d |
debug |
(logical) additional messages for debugging |
silent |
(logical) suppress messages |
This function retruns a list or array (as 2- or 3 dim) with possible number of occurances for each of the 3 elements in nMax. Read results vertical : out[[1]] or out[,,1] .. (multiplicative) table for 1st element of nMax; out[,,2] .. for 2nd
combinatIntTable(c(1,1,1,2), include0=TRUE, asList=FALSE, silent=TRUE) ## Imagine we have 3 cities and the (maximum) voting participants per city : nMa <- c(Paris=2, Lyon=1, Strasbourg=1) combinatIntTable(nMa, include0=TRUE, asList=TRUE, silent=TRUE)combinatIntTable(c(1,1,1,2), include0=TRUE, asList=FALSE, silent=TRUE) ## Imagine we have 3 cities and the (maximum) voting participants per city : nMa <- c(Paris=2, Lyon=1, Strasbourg=1) combinatIntTable(nMa, include0=TRUE, asList=TRUE, silent=TRUE)
The aim of this function is to choose a fixed number (nCombin) of list-elments from lst and count the number of common values/words.
Furthermore, one can define levels to fine-tune the types of combinations to examine.
In case multiple combinations for a given level are possible, some basic summary statistics are provided, too.
combineAsN( lst, lev = NULL, nCombin = 3, remDouble = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )combineAsN( lst, lev = NULL, nCombin = 3, remDouble = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )
lst |
(list of character or integer vectors) main input |
lev |
(character) define groups of |
nCombin |
(integer) number of list-elements to combine from |
remDouble |
(logical) remove intra-duplicates (defaults to |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Note of caution :
With very long lists and/or high numbers of repeats of given levels, however, the computational effort incerases very much (like it does when using table).
Thus, when exploring all different combinations of large data-sets may easily result in queries consuming many ressources (RAM and processing time) !
It is recommended to start testing with test smaller sub-groups.
The main idea of this function is to count frequency of terms when combining different drawings.
For example, you ask students from different cities which are their preferred hobbies, they may have different preference depending on the city ( defined by lev).
Now, if you want to make groups of 3 students, possibly with one from each city (A ,B and C), you want to count (/estimate) the frequency of different combinations possible.
Thus, using this function all combinations of the students from city A with the students from city B and C will be made when counting the number of common hobbies (by nCombin students).
Then, all counting results will be summarized to the average count for the various categories (which hobbies were seen once, twice or 3 times...),
sem (standard error of the mean) and CI (95
Of course, the number of potential combinations may quickly get very large. Using the argument remDouble=TRUE you can limit the search to
either finding all students giving the same answer plus all student giving different answers.
In this case, when a given level appears multiple times, all possible combinations using one of the respective entries will be be made with the other levels.
This function returns an array with 3 dimensions : i) ii) the combinations of nCombin list-elements,
iii) the number of counts (n), sem (standard error of the mean), CI (confidence interval) and sd
## all list-elements are considered equal tm1 <- list(a1=LETTERS[1:17], a2=LETTERS[3:19], a3=LETTERS[6:20], a4=LETTERS[8:22]) combineAsN(tm1, lev=gl(1,4))[,1,] ## different levels/groups in list-elements tm4 <- list(a1=LETTERS[1:15], a2=LETTERS[3:16], a3=LETTERS[6:17], a4=LETTERS[8:19], b1=LETTERS[5:19], b2=LETTERS[7:20], b3=LETTERS[11:24], b4=LETTERS[13:25], c1=LETTERS[17:26], d1=LETTERS[4:12], d2=LETTERS[5:11], d3=LETTERS[6:12], e1=LETTERS[7:10]) te4 <- combineAsN(tm4, nCombin=4, lev=substr(names(tm4),1,1)) str(te4) te4[,,1]## all list-elements are considered equal tm1 <- list(a1=LETTERS[1:17], a2=LETTERS[3:19], a3=LETTERS[6:20], a4=LETTERS[8:22]) combineAsN(tm1, lev=gl(1,4))[,1,] ## different levels/groups in list-elements tm4 <- list(a1=LETTERS[1:15], a2=LETTERS[3:16], a3=LETTERS[6:17], a4=LETTERS[8:19], b1=LETTERS[5:19], b2=LETTERS[7:20], b3=LETTERS[11:24], b4=LETTERS[13:25], c1=LETTERS[17:26], d1=LETTERS[4:12], d2=LETTERS[5:11], d3=LETTERS[6:12], e1=LETTERS[7:10]) te4 <- combineAsN(tm4, nCombin=4, lev=substr(names(tm4),1,1)) str(te4) te4[,,1]
This function aims to address the situation when two somehow different groupins (of the same data) exist and need to be joined.
It is not necessary that both alternative groupings use the same labels, neither.
combineByEitherFactor adds new (last) column named 'grp' to input matrix representing the combined factor
relative to 2 specified columns from input matrix mat (via 'refC1','refC2'). Optionally, the output may be
sorted and a column giving n per factor-level may be added.
The function treats selected columns of mat
as pairwise combination of 2 elements (that may occur multiple times over all lines of mat)
and sorts/organizes all instances of such combined elements (ie from both selected columns) as repeats of a given group,
who's class number is given in output column 'grp', the (total) number of repeats may be displayed in column 'nGrp' ( nByGrp=TRUE).
If groups are overlapping (after re-ordering), an iterative process of max 3x2 passes will be launched after initial matching.
Works on numeric as well as character input.
combineByEitherFactor( mat, refC1, refC2, nByGrp = FALSE, convergeMax = TRUE, callFrom = NULL, debug = FALSE, silent = FALSE )combineByEitherFactor( mat, refC1, refC2, nByGrp = FALSE, convergeMax = TRUE, callFrom = NULL, debug = FALSE, silent = FALSE )
mat |
main input matrix |
refC1 |
(integer) column-number of 'mat' to use as 1st set |
refC2 |
(integer) column-number of 'mat' to use as 2nd set |
nByGrp |
(logical) add last col with n by group |
convergeMax |
(logical) if |
callFrom |
(character) allow easier tracking of message(s) produced |
debug |
(logical) display additional messages for debugging |
silent |
(logical) suppress messages |
This function returns a matrix containing both selected columns plus additional column(s) indicating group-number of the pair-wise combination (and optional the total n by group)
nn <- rep(c("a","e","b","c","d","g","f"),c(3,1,2,2,1,2,1)) qq <- rep(c("m","n","p","o","q"),c(2,1,1,4,4)) nq <- cbind(nn,qq)[c(4,2,9,11,6,10,7,3,5,1,12,8),] combineByEitherFactor(nq,1,2,nBy=TRUE); combineByEitherFactor(nq,1,2,nBy=FALSE) combineByEitherFactor(nq,1,2,conv=FALSE); combineByEitherFactor(nq,1,2,conv=TRUE) ## mm <- rep(c("a","b","c","d","e"),c(3,4,2,3,1)); pp <- rep(c("m","n","o","p","q"),c(2,2,2,2,5)) combineByEitherFactor(cbind(mm,pp), 1, 2, con=FALSE, nBy=TRUE) combineByEitherFactor(cbind(mm,pp), 1, 2, con=TRUE, nBy=TRUE)nn <- rep(c("a","e","b","c","d","g","f"),c(3,1,2,2,1,2,1)) qq <- rep(c("m","n","p","o","q"),c(2,1,1,4,4)) nq <- cbind(nn,qq)[c(4,2,9,11,6,10,7,3,5,1,12,8),] combineByEitherFactor(nq,1,2,nBy=TRUE); combineByEitherFactor(nq,1,2,nBy=FALSE) combineByEitherFactor(nq,1,2,conv=FALSE); combineByEitherFactor(nq,1,2,conv=TRUE) ## mm <- rep(c("a","b","c","d","e"),c(3,4,2,3,1)); pp <- rep(c("m","n","o","p","q"),c(2,2,2,2,5)) combineByEitherFactor(cbind(mm,pp), 1, 2, con=FALSE, nBy=TRUE) combineByEitherFactor(cbind(mm,pp), 1, 2, con=TRUE, nBy=TRUE)
Search points in x,y space that are located very close and thus likely to overlap. In case of points close enough, various options for joining names (and shortening longer descriptions) are available.
combineOverlapInfo( dat, suplInfo = NULL, disThr = 0.01, addNsimil = TRUE, txtSepChar = ",", combSym = "+", maxOverl = 50, callFrom = NULL, debug = FALSE, silent = FALSE )combineOverlapInfo( dat, suplInfo = NULL, disThr = 0.01, addNsimil = TRUE, txtSepChar = ",", combSym = "+", maxOverl = 50, callFrom = NULL, debug = FALSE, silent = FALSE )
dat |
(matrix) matrix or data.frame with 2 cols (used ONLY 1st & 2nd column !), used as x & y coordinates |
suplInfo |
(NULL or character) when points are considered overlapping the text from 'suplInfo' will be reduced to fragment before 'txtSepChar' and combined (with others from overlapping text) using 'combSym', if NULL $combInf will appear with row-numbers |
disThr |
(numeric) distance-thrshold for considering as similar via searchDataPairs() |
addNsimil |
(logical) include number of fused points |
txtSepChar |
(character) for use with .retain1stPart(): where to cut (& keep 1st part) text from 'suplInfo' to return in out$CombInf; only 1st element used ! |
combSym |
(character) concatenation symbol (character, length=1) for points considered overlaying, see also 'suplInfo' |
maxOverl |
(integer) if NULL no limit or max limit of group/clu size (avoid condensing too many neighbour points to single cloud) |
callFrom |
(character) allow easier tracking of messages produced |
debug |
(logical) additional messages for debugging |
silent |
(logical) suppres messages |
This function returns a matrix with fused (condensed) information for cluster of overapping points
set.seed(2013) datT2 <- matrix(round(rnorm(200)+3,1),ncol=2,dimnames=list(paste("li",1:100,sep=""), letters[23:24])) # (mimick) some short and longer names for each line inf2 <- cbind(sh=paste(rep(letters[1:4],each=26),rep(letters,4),1:(26*4),sep=""), lo=paste(rep(LETTERS[1:4],each=26),rep(LETTERS,4),1:(26*4),",",rep(letters[sample.int(26)],4), rep(letters[sample.int(26)],4),sep=""))[1:100,] head(datT2,n=10) head(combineOverlapInfo(datT2,disThr=0.03),n=10) head(combineOverlapInfo(datT2,suplI=inf2[,2],disThr=0.03),n=10)set.seed(2013) datT2 <- matrix(round(rnorm(200)+3,1),ncol=2,dimnames=list(paste("li",1:100,sep=""), letters[23:24])) # (mimick) some short and longer names for each line inf2 <- cbind(sh=paste(rep(letters[1:4],each=26),rep(letters,4),1:(26*4),sep=""), lo=paste(rep(LETTERS[1:4],each=26),rep(LETTERS,4),1:(26*4),",",rep(letters[sample.int(26)],4), rep(letters[sample.int(26)],4),sep=""))[1:100,] head(datT2,n=10) head(combineOverlapInfo(datT2,disThr=0.03),n=10) head(combineOverlapInfo(datT2,suplI=inf2[,2],disThr=0.03),n=10)
This function works similar to unique, but it takes a matrix as input and considers one specified column to find unique instances.
It identifies 'repeated' lines of the input-matrix (or data.frame) 'mat' based on (repeated) elements in/of column with name 'colNa' (or column-number).
Redundant lines (ie repeated lines) will disappear in output.
Eg used with extracted annotation where 1 gene has many lines for different GO annotation.
combineRedBasedOnCol(mat, colNa, sep = ",", silent = FALSE, callFrom = NULL)combineRedBasedOnCol(mat, colNa, sep = ",", silent = FALSE, callFrom = NULL)
mat |
input matrix or data.frame |
colNa |
character vector (length 1) macting 1 column name (if mult only 1st will be used), in case of mult matches only 1st used |
sep |
(character) separator (default=",") |
silent |
(logical) suppress messages |
callFrom |
(character) allow easier tracking of messages produced |
matrix containing the input matrix without lines considered repeated (unique-like)
findRepeated, firstOfRepLines, organizeAsListOfRepl, combineRedundLinesInList
matr <- matrix(c(letters[1:6],"h","h","f","e",LETTERS[1:5]),ncol=3, dimnames=list(letters[11:15],c("xA","xB","xC"))) combineRedBasedOnCol(matr,colN="xB") combineRedBasedOnCol(rbind(matr[1,],matr),colN="xB")matr <- matrix(c(letters[1:6],"h","h","f","e",LETTERS[1:5]),ncol=3, dimnames=list(letters[11:15],c("xA","xB","xC"))) combineRedBasedOnCol(matr,colN="xB") combineRedBasedOnCol(rbind(matr[1,],matr),colN="xB")
This function provides help for combining/summarizing lines of numeric data which may be summaried according to reference vector or matrix of annotation (part of the same input-list). The data and reference will be aligned and data corresponding to redundant information be combined/summarized.
combineRedundLinesInList( lst, refNa = "ref", datNa = "quant", refColNa = "GeneName", supRefColNa = NULL, summarizeType = "av", NA.rm = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )combineRedundLinesInList( lst, refNa = "ref", datNa = "quant", refColNa = "GeneName", supRefColNa = NULL, summarizeType = "av", NA.rm = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )
lst |
(list) main input, containing matrix or data.frame of numeric data (see |
refNa |
(character) name of list-element containing annotation |
datNa |
(character) name(s) of list-element(s) containing numeric/quantitation data |
refColNa |
(character) in case the list-element to be used as reference is |
supRefColNa |
(character) in case the |
summarizeType |
(character) the summarization method gets specified here; so far 'sum','av','med','first' and 'last' are implemented |
NA.rm |
(logical) pass to summarizing functions order to omit |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
All input data should be in a list, ie one or multipl matrix or data.frame for numeric data (see argument datNa), as well as the reference (see argument refNa).
The refgerence may be a named character vecor or a matrix for which the column to be used should be specified using the argument refColNa.
In case the annotation is a matrix, the rownames will be used as unique/independent identifyers to adjust potentially different order of numeric data and annotation.
In absence of rownames, an additional column supRefColNa of the annotation may be designed for adjusting the order of annotation and numeric data.
The numeric list may contain multiple matrixes or data.frames which will all be summarized by the same procedure as long as they have the same initial dimensions and are specified by refNa.
Please note that all other list elements from input not specified by refNa (or datNa) will be maintained in the output just as they are.
This function returns a list of same length as input
findRepeated, firstOfRepLines, organizeAsListOfRepl, combineRedBasedOnCol
x1 <- list(quant=matrix(11:34, ncol=3, dimnames=list(letters[8:1], LETTERS[11:13])), annot=matrix(paste0(LETTERS[c(1:4,6,3:5)],LETTERS[c(1:4,6,3:5)]), ncol=1, dimnames=list(paste(letters[1:8]),"xx")) ) combineRedundLinesInList(lst=x1, refNa="annot", datNa="quant", refColNa="xx")x1 <- list(quant=matrix(11:34, ncol=3, dimnames=list(letters[8:1], LETTERS[11:13])), annot=matrix(paste0(LETTERS[c(1:4,6,3:5)],LETTERS[c(1:4,6,3:5)]), ncol=1, dimnames=list(paste(letters[1:8]),"xx")) ) combineRedundLinesInList(lst=x1, refNa="annot", datNa="quant", refColNa="xx")
The function combineRedundLinesInListAcRef() has been deprecated and replaced by combineRedundLinesInList() from the same package
combineRedundLinesInListAcRef( lst, listNa = c("ref", "quant"), refColNa = "xx", summarizeType = "av", NA.rm = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )combineRedundLinesInListAcRef( lst, listNa = c("ref", "quant"), refColNa = "xx", summarizeType = "av", NA.rm = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )
lst |
(list) main input |
listNa |
(character) names of list-elements containing quantitation data (1st position) and protein/line annotation (2nd position) |
refColNa |
(character) in case the list-element to be used as reference is |
summarizeType |
(character) the summarization method gets specified here; so far 'sum','av','med','first' and 'last' are implemented |
NA.rm |
(logical) pass to summarizing functions order to omit |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns a list of same length as input
x1 <- list(quant=matrix(11:34, ncol=3, dimnames=list(letters[8:1], LETTERS[11:13])), annot=matrix(paste0(LETTERS[c(1:4,6,3:5)],LETTERS[c(1:4,6,3:5)]), ncol=1, dimnames=list(paste(letters[1:8]),"xx")) ) ## please use combineRedundLinesInList() combineRedundLinesInList(lst=x1, refNa="annot", datNa="quant", refColNa="xx")x1 <- list(quant=matrix(11:34, ncol=3, dimnames=list(letters[8:1], LETTERS[11:13])), annot=matrix(paste0(LETTERS[c(1:4,6,3:5)],LETTERS[c(1:4,6,3:5)]), ncol=1, dimnames=list(paste(letters[1:8]),"xx")) ) ## please use combineRedundLinesInList() combineRedundLinesInList(lst=x1, refNa="annot", datNa="quant", refColNa="xx")
Suppose multiple measures (like multiple chanels) are taken for subjects and these measures are organized as groups in a list, like muliple parameters (= channels) or types of measurements (typically many paramters are recorded when screeinig compounds in microtiter plates). Within one parameter/channel all replicate-data from separate list-entries ('lst') will get combined according to names of list-elements. The function will trim any redundant text in names of list-elements, try to isolate separator (may vary among replicate-groups, but should be 1 character long). eg names "hct116 1.1.xlsx" & "hct116 1.2.xlsx" will be combined as replicates, "hct116 2.1.xlsx" will be considered as new group.
combineReplFromListToMatr(lst, silent = FALSE, debug = FALSE, callFrom = NULL)combineReplFromListToMatr(lst, silent = FALSE, debug = FALSE, callFrom = NULL)
lst |
(list) list of arrays (typically multi-parameter measures of micortiterplate data) |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns a list of arrays now with same dimension of arrays (but shorter, since replicate-arrays were combined)
extr1chan, organizeAsListOfRepl
lst2 <- list(aa_1x=matrix(1:12,nrow=4,byrow=TRUE),ab_2x=matrix(24:13,nrow=4,byrow=TRUE)) combineReplFromListToMatr(lst2)lst2 <- list(aa_1x=matrix(1:12,nrow=4,byrow=TRUE),ab_2x=matrix(24:13,nrow=4,byrow=TRUE)) combineReplFromListToMatr(lst2)
This function addresses the case when multiple alternatove ways exit to combine two elements.
combineSingleT makes combinatory choices : if multiple TRUE in given column of 'mat' make all multiple selections with always one TRUE from each column
The resultant output contains index for first and second input columns elements to be combined.
combineSingleT(mat, silent = FALSE, debug = FALSE, callFrom = NULL)combineSingleT(mat, silent = FALSE, debug = FALSE, callFrom = NULL)
mat |
2-column matrix of logical values |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
This function returns a matrix with indexes of conbinations of TRUE
## Example: Fist column indicates which boys want to dance and second column ## which girls want to dance. So if several boys want to dance each of the girls ## will have the chance to dance with each of them. matr <- matrix(c(TRUE,FALSE,TRUE,FALSE,TRUE,FALSE),ncol=2) combineSingleT(matr)## Example: Fist column indicates which boys want to dance and second column ## which girls want to dance. So if several boys want to dance each of the girls ## will have the chance to dance with each of them. matr <- matrix(c(TRUE,FALSE,TRUE,FALSE,TRUE,FALSE),ncol=2) combineSingleT(matr)
This functions aims to inspect repeating structues of data given as list of arrays and will try to complete arrays with fewer lines or columns (as this may appear eg with the very last set of high-thourput sceening data if fewer measures remain in the last set). Thus, the dimensions of the arrays are compared and cases with fewer (lost) columns (eg fewer experimental replicates) will be adjust/complete by adding column(s) of NA. Used eg when at reading mircotiterplate data the last set is not complete.
completeArrLst(arrLst, silent = FALSE, debug = FALSE, callFrom = NULL)completeArrLst(arrLst, silent = FALSE, debug = FALSE, callFrom = NULL)
arrLst |
(list) list of arrays (typically 1st and 2nd dim for specific genes/objects, 3rd for different measures associated with) |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of message(s) produced |
This function returns a list of arrays, now with same dimension of arrays
organizeAsListOfRepl, extr1chan
arr1 <- array(1:24,dim=c(4,3,2),dimnames=list(c(LETTERS[1:4]), paste("col",1:3,sep=""),c("ch1","ch2"))) arr3 <- array(81:96,dim=c(4,2,2),dimnames=list(c(LETTERS[1:4]), paste("col",1:2,sep=""),c("ch1","ch2"))) arrL3 <- list(pl1=arr1,pl3=arr3) completeArrLst(arrL3)arr1 <- array(1:24,dim=c(4,3,2),dimnames=list(c(LETTERS[1:4]), paste("col",1:3,sep=""),c("ch1","ch2"))) arr3 <- array(81:96,dim=c(4,2,2),dimnames=list(c(LETTERS[1:4]), paste("col",1:2,sep=""),c("ch1","ch2"))) arrL3 <- list(pl1=arr1,pl3=arr3) completeArrLst(arrL3)
This is a _match()_-like function allowing to serach among concatenated terms/IDs, additional options to remove text pattern like terminal lowercase extesion are available.
The function returns a named vector indicating the positions of (first) matches similar to match.
concatMatch( x, table, sep = ",", sepPattern = NULL, globalPat = "digitExtension", nomatch = NA_integer_, incomparables = NULL, extensPat = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )concatMatch( x, table, sep = ",", sepPattern = NULL, globalPat = "digitExtension", nomatch = NA_integer_, incomparables = NULL, extensPat = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )
x |
(vector) the values to be matched |
table |
(vector) the values to be matched against (ie reference) |
sep |
(character) separator character in case concatenation of entries is tested |
sepPattern |
(character or |
globalPat |
(character) pattern for additional trimming of serach-terms. If |
nomatch |
(vector) similar to |
incomparables |
(vector) similar to |
extensPat |
(logical) similar to |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
The main motivation to create this function was to be able to treat concatenated entries and to look if any of the concatenated values match to 'x'.
This function offers additional options for trimming values before running the main comparison.
Of course, the concatenation strategy must be known and only a single concatenation separator (which may be multiple characters long) may be used for both x and match.
Thus result will only indicate that at least one of the concatenated terms had a match, but not which one.
Finally, both vectors x and table may contain concatenated terms.
In this case this function will require much more computational ressources due to the increased combinatorics when comparing larger vectors.
Please note, that in case of multiple to multiple matches, only the first hit gets reported.
The argument globalPat="digitExtension" allows eg reducing 'A1234-4' to 'A1234'.
This function returns a character vector with verified path and file-name(s), returns NULL if nothing
match (for two simple vectors without concatenated terms), grep
tab1 <- c("AA","BB-5","CCab","FF") tab2 <- c("AA","WW,Vde,BB-5,E","CCab","FF,Uef") x1 <- c("ZZ","YY","AA","BB-2","DD","CCdef","Dxy") # modif of single ID (no concat) concatMatch(x1, tab2) x2 <- c("ZZ,Z","YY,Y","AA,Z,Y","BB-2","DD","X,CCdef","Dxy") # conatenated in 'x' concatMatch(x2, tab2) tab1 <- c("AA","BB-5","CCab","FF") # no conatenated in 'table' concatMatch(x2, tab1) # simple case of no concat anywhere concatMatch(x1, tab1)tab1 <- c("AA","BB-5","CCab","FF") tab2 <- c("AA","WW,Vde,BB-5,E","CCab","FF,Uef") x1 <- c("ZZ","YY","AA","BB-2","DD","CCdef","Dxy") # modif of single ID (no concat) concatMatch(x1, tab2) x2 <- c("ZZ,Z","YY,Y","AA,Z,Y","BB-2","DD","X,CCdef","Dxy") # conatenated in 'x' concatMatch(x2, tab2) tab1 <- c("AA","BB-5","CCab","FF") # no conatenated in 'table' concatMatch(x2, tab1) # simple case of no concat anywhere concatMatch(x1, tab1)
This little function returns the confidence interval associated to a given significance level alpha under the hypothesis of the Normal distribution is valid.
confInt(x, alpha = 0.05, distrib = "Normal", silent = FALSE, callFrom = NULL)confInt(x, alpha = 0.05, distrib = "Normal", silent = FALSE, callFrom = NULL)
x |
(numeric) main input |
alpha |
(numeric) significance level, accepted type I error |
distrib |
(character) distribution, so far only |
silent |
(logical) suppress messages |
callFrom |
(character) allow easier tracking of message(s) produced |
This function returns the confidence interval to a given alpha under the hypothesis of the Normal distribution.
confInt(c(5,2:6))confInt(c(5,2:6))
This function helps investigating tree-like structures with the aim of indicating how much individual tree components contribute to compose long stretches.
contribToContigPerFrag( joinMat, fullLength = NULL, nDig = 3, silent = FALSE, callFrom = NULL, debug = FALSE )contribToContigPerFrag( joinMat, fullLength = NULL, nDig = 3, silent = FALSE, callFrom = NULL, debug = FALSE )
joinMat |
(matrix) matrix with concatenated edges as rownames (separated by slashes), column |
fullLength |
(integer) custom total length (useful if the concatenated edges do not cover 100 percent of the original precursor whose fragments are studied) |
nDig |
(integer) rounding: number of digits for 3rd column |
silent |
(logical) suppress messages |
callFrom |
(character) allow easier tracking of messages produced |
debug |
(logical) additional messages for debugging |
contribToContigPerFrag characterizes individual (isolated) contribution of single edges in tree-structures.
Typically used to process/exploit summarized trees (as matrix) made by buildTree which makes use of the package data.tree.
For example if A,B and C can be joined aa well and B +D, this function will check if A+B+C is longer and if A contributes to the longest tree.
This function returns a matrix of 3 columns for each node identified in rownames of joinMatr for length of longest tree-branches where given edge participates (column sumLen), the (total) number of edges therein (col n.frag) and a relative value (len.rat)
to build tree buildTree
path1 <- matrix(c(17,19,18,17, 4,4,2,3), ncol=2, dimnames=list(c("A/B/C/D","A/B/G/D","A/H","A/H/I"),c("sumLen","n"))) contribToContigPerFrag(path1)path1 <- matrix(c(17,19,18,17, 4,4,2,3), ncol=2, dimnames=list(c("A/B/C/D","A/B/G/D","A/H","A/H/I"),c("sumLen","n"))) contribToContigPerFrag(path1)
conv01toColNa transforms matrix of integers (eg 0 and 1) to repeated & concatenated text from argument colNa,
the character string for 0 occurances of argument zeroTex may be customized.
Used eg when specifying (and concatenating) various counted elements (eg properties) along a vector like variable peptide modifications in proteomics.
conv01toColNa(mat, colNa = NULL, zeroTex = "", pasteCol = FALSE)conv01toColNa(mat, colNa = NULL, zeroTex = "", pasteCol = FALSE)
mat |
input matrix (with integer values) |
colNa |
alternative (column-)names to the ones from 'mat' (default colnames of 'mat') |
zeroTex |
text to display if 0 (default "") |
pasteCol |
(logical) allows to collapse all columns to single chain of characters in output |
character vector
(ma1 <- matrix(sample(0:3,40,repl=TRUE), ncol=4, dimnames=list(NULL, letters[11:14]))) conv01toColNa(ma1) conv01toColNa(ma1, colNa=LETTERS[1:4], ze=".") conv01toColNa(ma1, colNa=LETTERS[1:4], pasteCol=TRUE)(ma1 <- matrix(sample(0:3,40,repl=TRUE), ncol=4, dimnames=list(NULL, letters[11:14]))) conv01toColNa(ma1) conv01toColNa(ma1, colNa=LETTERS[1:4], ze=".") conv01toColNa(ma1, colNa=LETTERS[1:4], pasteCol=TRUE)
This function alows (re-)defining a new transparency. A color encoding vector will be transformed to the same color(s) but with new transparency (alpha).
convColorToTransp(color, alph = 1)convColorToTransp(color, alph = 1)
color |
(character) color input |
alph |
(numeric) transparency value (1 for no transparency, 0 for complete opaqueness), values <1 will be treated as percent-values |
character vector (of same length as input) with color encoding for new transparency
col0 <- c("#998FCC","#5AC3BA","#CBD34E","#FF7D73") col1 <- convColorToTransp(col0,alph=0.7) layout(1:2) pie(rep(1,length(col0)),col=col0) pie(rep(1,length(col1)),col=col1,main="new transparency")col0 <- c("#998FCC","#5AC3BA","#CBD34E","#FF7D73") col1 <- convColorToTransp(col0,alph=0.7) layout(1:2) pie(rep(1,length(col0)),col=col0) pie(rep(1,length(col1)),col=col1,main="new transparency")
This function provides flexible converting of matrix to data.frame.
For example repeated/redundant rownames are not allowed in data.frame(), thus the corresponding column-names have to be renamed using a counter-suffix.
In case of non-redundant rownames, a new column 'addIniNa' will be introduced at beginning to document the initial (redundant) rownames,
non-redundant rownames will be created.
Finally, this functions converts the corrected matrix to data.frame and checks/converts columns for transforming character to numeric if possible.
If the input is a data.frame containing factors, they will be converted to character before potential conversion.
Note: for simpler version (only text to numeric) see from this package .convertMatrToNum .
convMatr2df( mat, addIniNa = TRUE, duplTxtSep = "_", silent = FALSE, callFrom = NULL )convMatr2df( mat, addIniNa = TRUE, duplTxtSep = "_", silent = FALSE, callFrom = NULL )
mat |
matrix (or data.frame) to be converted |
addIniNa |
(logical) if |
duplTxtSep |
(character) separator for enumerating replicated names |
silent |
(logical) suppres messages |
callFrom |
(character) allow easier tracking of message(s) produced |
This functions returns a data.frame equivalent to the input matrix, an additional column named 'ID' will be added for initial rownames
numeric, for simpler version (only text to numeric) see from this package .convertMatrToNum
dat1 <- matrix(1:10, ncol=2) rownames(dat1) <- letters[c(1:3,2,5)] ## as.data.frame(dat1) ... would result in an error convMatr2df(dat1) df1 <- data.frame(a=as.character((1:3)/2), b=LETTERS[1:3], c=1:3) str(convMatr2df(df1)) df2 <- df1; df2$b <- as.factor(df2$b) str(convMatr2df(df2))dat1 <- matrix(1:10, ncol=2) rownames(dat1) <- letters[c(1:3,2,5)] ## as.data.frame(dat1) ... would result in an error convMatr2df(dat1) df1 <- data.frame(a=as.character((1:3)/2), b=LETTERS[1:3], c=1:3) str(convMatr2df(df1)) df2 <- df1; df2$b <- as.factor(df2$b) str(convMatr2df(df2))
This function aims to help getting organized with pairwise (statistical) testing since there are multiple ways of expressing how samples should be grouped for tests. For example this may be either as combined character strings (eg 'A-B') or as separate elements. This function takes most input-formats and returns multiple converted formats.
convPairwiseSetup( useComparison, grp, experSetup = NULL, sep = NULL, silent = FALSE, debug = FALSE, callFrom = NULL )convPairwiseSetup( useComparison, grp, experSetup = NULL, sep = NULL, silent = FALSE, debug = FALSE, callFrom = NULL )
useComparison |
(numeric or character vector or matrix) the argument allowing to specify the pairwise comparions
may be character as result of combining two group-names (from argument |
grp |
(character or factor) vector defining groups of replicates for additional checking (may also be just the levels of grp) |
experSetup |
(list) optional esperimental setup (list with $ind, $pwGrpIndex,$sep and $pwGrpNa as obtained using |
sep |
(character) optional custom separator to use for splitting |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
This function returns a list with $pwGrpNa (matrix with separated elements), $pwIndex (matrix with separated indexes), $grpNa (levels of grp, ie sorted),
$sep (character vecor of separator found/used or suggested), $concat (pairwise concatenated names, eg 'A-B')
This function returns a list with $data, $nNA, $randParam, $NAneigLst, $seed, $filt, and $annot
presenceFilt, getPWseparator, indexGroupsFromPW, getPairwiseSetup, strsplit;
getPWseparator for default optimal separator; this function is used in moderTestXgrp
convPairwiseSetup(c("B-C","D-A"), LETTERS[1:4]) convPairwiseSetup(c("B","C"), LETTERS[1:3]) convPairwiseSetup("all", LETTERS[1:3]) convPairwiseSetup(2:3, LETTERS[1:3]) convPairwiseSetup(2:3, LETTERS[1:3], sep="__") convPairwiseSetup(matrix(c("B","D","C","A"), ncol=2), LETTERS[1:4])convPairwiseSetup(c("B-C","D-A"), LETTERS[1:4]) convPairwiseSetup(c("B","C"), LETTERS[1:3]) convPairwiseSetup("all", LETTERS[1:3]) convPairwiseSetup(2:3, LETTERS[1:3]) convPairwiseSetup(2:3, LETTERS[1:3], sep="__") convPairwiseSetup(matrix(c("B","D","C","A"), ncol=2), LETTERS[1:4])
This function checks if input vector/character string contains numbers (with or without comma) and attempts converting to numeric.
This functions was designed for extracting the numeric part of character-vectors (or matrix) containing both numbers and character-elements.
Depending on the parameters convert and remove text-entries can be converted to NA (in resulting numeric objects) or removed (the number of elements/lines gets reduced, in consequece).
Note: if 'x' is a matrix, its matrix-dimensions & -names will be preserved.
Note: so far Inf and -Inf do not get recognized as numeric.
convToNum( x, autoConv = TRUE, spaceRemove = TRUE, convert = c(NA, "sparseChar"), remove = NULL, euroStyle = TRUE, sciIncl = TRUE, callFrom = NULL, silent = TRUE, debug = FALSE )convToNum( x, autoConv = TRUE, spaceRemove = TRUE, convert = c(NA, "sparseChar"), remove = NULL, euroStyle = TRUE, sciIncl = TRUE, callFrom = NULL, silent = TRUE, debug = FALSE )
x |
vector to be converted |
autoConv |
(logical) simple automatic conversion based on function |
spaceRemove |
(logical) to remove all heading and trailing (white) space (until first non-space character) |
convert |
(character) define which type of non-conform entries to convert to NAs. Note, if |
remove |
(character) define which type of non-conform entries to remove, removed items cannot be converted to |
euroStyle |
(logical) if |
sciIncl |
(logical) include recognizing scientific notation (eg 2e-4) |
callFrom |
(character) allow easier tracking of messages produced |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
This function may be used in two modes, depening if argument autoConv is TRUE or FALSE.
The first options allows accessing an automatic mode based on as.numeric,
while the second options investigates all characters if they may belong to numeric expressions and allows removing specific text-elements.
This function returns a numeric vector (or matrix (if 'x' is matrix))
numeric and as.numeric (on same help-page)
x1 <- c("+4"," + 5","6","bb","Na","-7") convToNum(x1) convToNum(x1, autoConv=FALSE, convert=c("allChar")) convToNum(x1, autoConv=FALSE) # too many non-numeric instances for 'sparseChar' x2 <- c("+4"," + 5","6","-7"," - 8","1e6","+ 2.3e4","-3E4","- 4E5") convToNum(x2) convToNum(x2, autoConv=FALSE, convert=NA,remove=c("allChar",NA)) convToNum(x2, autoConv=FALSE, convert=NA,remove=c("allChar",NA),sciIncl=FALSE)x1 <- c("+4"," + 5","6","bb","Na","-7") convToNum(x1) convToNum(x1, autoConv=FALSE, convert=c("allChar")) convToNum(x1, autoConv=FALSE) # too many non-numeric instances for 'sparseChar' x2 <- c("+4"," + 5","6","-7"," - 8","1e6","+ 2.3e4","-3E4","- 4E5") convToNum(x2) convToNum(x2, autoConv=FALSE, convert=NA,remove=c("allChar",NA)) convToNum(x2, autoConv=FALSE, convert=NA,remove=c("allChar",NA),sciIncl=FALSE)
Get coordinates of values/points in matrix according to filtering condition
coordOfFilt(mat, cond, sortByRows = FALSE, silent = FALSE, callFrom = NULL)coordOfFilt(mat, cond, sortByRows = FALSE, silent = FALSE, callFrom = NULL)
mat |
(matrix or data.frame) matrix or data.frame |
cond |
(logical or integer) condition/test to see which values of |
sortByRows |
(logical) optional sorting of results by row-index |
silent |
(logical) suppress messages |
callFrom |
(character) allow easier tracking of message(s) produced |
matrix columns 'row' and 'col'
set.seed(2021); ma1 <- matrix(sample.int(n=40,size=27,replace=TRUE), ncol=9) ## let's test which values are >37 which(ma1 >37) # doesn't tell which row & col coordOfFilt(ma1, ma1 >37)set.seed(2021); ma1 <- matrix(sample.int(n=40,size=27,replace=TRUE), ncol=9) ## let's test which values are >37 which(ma1 >37) # doesn't tell which row & col coordOfFilt(ma1, ma1 >37)
correctToUnique checks 'x' for unique entries, while maintaining the original length. If necessary a counter will added to non-unique entries.
correctToUnique( x, sep = "_", atEnd = TRUE, maxIter = 4, NAenum = TRUE, silent = FALSE, callFrom = NULL )correctToUnique( x, sep = "_", atEnd = TRUE, maxIter = 4, NAenum = TRUE, silent = FALSE, callFrom = NULL )
x |
input character vector |
sep |
(character) separator used when counter |
atEnd |
(logical) decide location of placing the counter (at end or at beginning of initial text) |
maxIter |
(numeric) max number of iterations |
NAenum |
(logical) if |
silent |
(logical) suppress messages |
callFrom |
(character) for better tracking of use of functions |
This function returns a character vector
unique will simply remove repeated elements, ie length of 'x' won't remain constant, filtSizeUniq is more complex and slower, treatTxtDuplicates
correctToUnique(c("li0","n",NA,NA,rep(c("li2","li3"),2),rep("n",4)))correctToUnique(c("li0","n",NA,NA,rep(c("li2","li3"),2),rep("n",4)))
This function corrects paths character strings for mixed slash and backslash in file path.
In Windows the function tempdir() will use double backslashes as separator while file.path() uses regular slashes.
So when combining these two one might encounter a mix of slashes and double backslashes which may cause trouble, unless this is streightened out to a single separator used.
When pointig to given files inside html-files, paths need to have a prefix, this can be added using the argument asHtml.
correctWinPath( x, asHtml = FALSE, anyPlatf = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )correctWinPath( x, asHtml = FALSE, anyPlatf = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )
x |
(character) input path to test and correct |
asHtml |
(logical) option for use in html : add prefix "file:/" |
anyPlatf |
(logical, length=1) if |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
This function returns a character vector with corrected path
path1 <- 'D:\\temp\\Rtmp6X8/working_dir\\RtmpKC/example.txt' (path1b <- correctWinPath(path1, anyPlatf=TRUE)) (path1h <- correctWinPath(path1, anyPlatf=TRUE, asHtml=TRUE))path1 <- 'D:\\temp\\Rtmp6X8/working_dir\\RtmpKC/example.txt' (path1b <- correctWinPath(path1, anyPlatf=TRUE)) (path1h <- correctWinPath(path1, anyPlatf=TRUE, asHtml=TRUE))
This functions summarizes the serach of similar (or identical) numeric values from 2 initial vectors, it
evaluates the result from initial search run by findCloseMatch(), whose output is a less convenient list.
countCloseToLimits checks furthermore how many results within additional (more stringent)
distance-limits may be found and returns the number of distance values within the limits tested.
Designed for checking if threshold used with findCloseMatch() may be set more stringent, eg when searching reasonable FDR limits ...
countCloseToLimits( closeMatch, limitIdent = 5, prefix = "lim_", silent = FALSE, debug = FALSE, callFrom = NULL )countCloseToLimits( closeMatch, limitIdent = 5, prefix = "lim_", silent = FALSE, debug = FALSE, callFrom = NULL )
closeMatch |
(list) output from findCloseMatch(), ie list indicating which instances of 2 series of data have close matches |
limitIdent |
(numeric) max limit or panel of threshold values to test (if single value, in addtion a panel with values below will be tested) |
prefix |
(character) prefix for names of output |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns an integer vector with counts for number of list-elements with at least one absolue value below threshold, names
set.seed(2019); aa <- sample(12:15,20,repl=TRUE) +round(runif(20),2)-0.5 bb <- 11:18 match1 <- findCloseMatch(aa, bb, com="diff", lim=0.65) head(match1) (tmp3 <- countCloseToLimits(match1, lim=c(0.5,0.35,0.2))) (tmp4 <- countCloseToLimits(match1, lim=0.7))set.seed(2019); aa <- sample(12:15,20,repl=TRUE) +round(runif(20),2)-0.5 bb <- 11:18 match1 <- findCloseMatch(aa, bb, com="diff", lim=0.65) head(match1) (tmp3 <- countCloseToLimits(match1, lim=c(0.5,0.35,0.2))) (tmp4 <- countCloseToLimits(match1, lim=0.7))
Suppose a parent sequence/string 'ABCDE' gets cut in various fragments (eg 'ABC','AB' ...).
countSameStartEnd counts how many (ie re-occuring) start- and end- sites of edges do occur in the input-data.
The input is presented as matrix of/indicating start- and end-sites of edges.
The function is used to characterize partially redundant edges and accumulation of cutting/breakage sites.
countSameStartEnd( frag, minFreq = 2, nDig = 4, silent = FALSE, debug = FALSE, callFrom = NULL )countSameStartEnd( frag, minFreq = 2, nDig = 4, silent = FALSE, debug = FALSE, callFrom = NULL )
frag |
(matrix) 1st column |
minFreq |
(integer) min number of accumulated sites for taking into account (allows filtering with large datasets) |
nDig |
(integer) rounding: number of digits for columns |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced#' @return This function returns a matrix of 6 columns: input (beg and end), beg.n, beg.rat, end.n, end.rat |
to build initial tree buildTree, contribToContigPerFrag, simpleFragFig
frag1 <- cbind(beg=c(2,3,7,13,13,15,7,9,7, 3,3,5), end=c(6,12,8,18,20,20,19,12,12, 4,5,7)) rownames(frag1) <- letters[1:nrow(frag1)] countSameStartEnd(frag1) simpleFragFig(frag1)frag1 <- cbind(beg=c(2,3,7,13,13,15,7,9,7, 3,3,5), end=c(6,12,8,18,20,20,19,12,12, 4,5,7)) rownames(frag1) <- letters[1:nrow(frag1)] countSameStartEnd(frag1) simpleFragFig(frag1)
cutArrayInCluLike cuts 'dat' (matrix,data.frame or 3-dim array) in list (of appended lines) according to 'cluOrg',
which serves as instruction which line of 'dat' should be placed in which list-element (like sorting according to cluster-numbers).
cutArrayInCluLike(dat, cluOrg, silent = FALSE, debug = FALSE, callFrom = NULL)cutArrayInCluLike(dat, cluOrg, silent = FALSE, debug = FALSE, callFrom = NULL)
dat |
array (3 dim) |
cluOrg |
(factor) organization of lines to clusters |
silent |
(logical) suppress messages |
debug |
(logical) display additional messages for debugging |
callFrom |
(character) allow easier tracking of message(s) produced |
This function retruns a list of matrixes (or arrays)
mat1 <- matrix(1:30,nc=3,dimnames=list(letters[1:10],1:3)) cutArrayInCluLike(mat1,cluOrg=factor(c(2,rep(1:4,2),5)))mat1 <- matrix(1:30,nc=3,dimnames=list(letters[1:10],1:3)) cutArrayInCluLike(mat1,cluOrg=factor(c(2,rep(1:4,2),5)))
This function cuts character vector after 'cutAt' (ie keep the search subtsting 'cutAt', different to strsplit).
Used for theoretical enzymatic digestion (eg in proteomics)
cutAtMultSites(y, cutAt, silent = FALSE, debug = FALSE, callFrom = NULL)cutAtMultSites(y, cutAt, silent = FALSE, debug = FALSE, callFrom = NULL)
y |
character vector (better if of length=1, otherwise one won't know which fragment stems from which input) |
cutAt |
(character) search subtsting, ie 'cutting rule' |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns a modified (ie cut) character vector
strsplit, nFragments0, nFragments
tmp <- "MSVSRTMEDSCELDLVYVTERIIAVSFPSTANEENFRSNLREVAQMLKSKHGGNYLLFNLSERRPDITKLHAKVLEFGWPDLHTPALEKI" cutAtMultSites(c(tmp,"ojioRij"),c("R","K"))tmp <- "MSVSRTMEDSCELDLVYVTERIIAVSFPSTANEENFRSNLREVAQMLKSKHGGNYLLFNLSERRPDITKLHAKVLEFGWPDLHTPALEKI" cutAtMultSites(c(tmp,"ojioRij"),c("R","K"))
This function is a more elaborate version of cut for cutting a the content of a
numeric vector 'x' into a given number of groups, taken from the length of 'lev'.
Besides, this function provides the group borders/limits for convention use with legends.
cutToNgrp( x, lev, NAuse = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )cutToNgrp( x, lev, NAuse = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )
x |
numeric vector |
lev |
(character or numeric), the length of this argument tells the number of groups to be used for cutting |
NAuse |
(logical) include NAs as separate group |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
This function returns a list with $grouped telling which element of 'x' goes in which group and $legTxt with gourp-borders for convenient use with legends
set.seed(2019); dat <- runif(30) +(1:30)/2 cutToNgrp(dat,1:5) plot(dat,col=(1:5)[as.numeric(cutToNgrp(dat,1:5)$grouped)])set.seed(2019); dat <- runif(30) +(1:30)/2 cutToNgrp(dat,1:5) plot(dat,col=(1:5)[as.numeric(cutToNgrp(dat,1:5)$grouped)])
diffCombin returns matrix of differences (eg resulting from subsititution) for all pairwise combinations of numeric vector 'x'.
diffCombin( x, diagAsNA = FALSE, prefix = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )diffCombin( x, diagAsNA = FALSE, prefix = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )
x |
numeric vector to compute differences for all combinations |
diagAsNA |
(logical) return all self-self combinations as NA (otherwise 0) |
prefix |
(logical) if TRUE, dimnames of output will specify orientation (prefix='from.' and 'to.') |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
This function returns a numeric matrix of all pairwise differences
diff for simple differences
diffCombin(c(10,11.1,13.3,16.6))diffCombin(c(10,11.1,13.3,16.6))
This is a diff()-like function to return difference in ppm between subsequent values.
Result is oriented, ie neg ppm value means decrease (from higher to lower value). Note that if the absolute difference remains the same the difference in ppm will not remain same.
Any difference to NA is returned as NA, thus a single NA will result in two NAs in output (unless NA is 1st or last).
diffPPM(dat, toPrev = FALSE, silent = FALSE, callFrom = NULL)diffPPM(dat, toPrev = FALSE, silent = FALSE, callFrom = NULL)
dat |
(numeric) vector for calculating difference to preceeding/following value in ppm |
toPrev |
(logical) determine oriention |
silent |
(logical) suppress messages |
callFrom |
(character) allows easier tracking of messages produced |
This function returns a list with close matches of 'x' to given 'y', the numeric value dependes on 'sortMatch' (if FALSE then always value of 'y' otherwise of longest of x&y)
checkSimValueInSer and (from this package) .compareByDiff, diff
aa <- c(1000.01, 1000.02, 1000.05, 1000.08, 1000.09, 1000.08) .compareByPPM(list(aa,aa), 30, TRUE) # tabular 'long' version diffPPM(aa)aa <- c(1000.01, 1000.02, 1000.05, 1000.08, 1000.09, 1000.08) .compareByPPM(list(aa,aa), 30, TRUE) # tabular 'long' version diffPPM(aa)
This function reduces number of rows in 'dat' by eliminating lines where x & y coordinates (columns of matrix 'dat' defined by 'useCol') are identical (overlay points) or very close.
The stringency for 'close' values may be fine-tuned using nDig), this function uses internally firstOfRepeated.
elimCloseCoord( dat, useCol = 1:2, elimIdentOnly = FALSE, refine = 2, nDig = 3, callFrom = NULL, silent = FALSE )elimCloseCoord( dat, useCol = 1:2, elimIdentOnly = FALSE, refine = 2, nDig = 3, callFrom = NULL, silent = FALSE )
dat |
matrix (or data.frame) with main numeric input |
useCol |
(numeric) index for numeric columns of 'dat' to use/consider |
elimIdentOnly |
(logical) if TRUE, eliminate real duplicated points only (ie identical values only) |
refine |
(numeric) allows increasing stringency even further (higher 'refine' .. more lines considered equal) |
nDig |
(integer) number of significant digits used for rounding, if two 'similar' values are identical after this rounding the second will be eliminated. |
callFrom |
(character) allows easier tracking of messages produced |
silent |
(logical) suppress messages |
This function returns the resultant matrix/data.frame
findCloseMatch, firstOfRepeated
da1 <- matrix(c(rep(0:4,5),0.01,1.1,2.04,3.07,4.5),nc=2); da1[,1] <- da1[,1]*99; head(da1) elimCloseCoord(da1)da1 <- matrix(c(rep(0:4,5),0.01,1.1,2.04,3.07,4.5),nc=2); da1[,1] <- da1[,1]*99; head(da1) elimCloseCoord(da1)
equLenNumber convert numeric entry 'x' to text, with all elements getting the same number of characters (ie by adding preceeding or tailing 0s, if needed).
So far, this function cannot handle scientific annotations.
equLenNumber(x, silent = FALSE, callFrom = NULL, debug = FALSE)equLenNumber(x, silent = FALSE, callFrom = NULL, debug = FALSE)
x |
(caracter) input vector |
silent |
(logical) suppress messages |
callFrom |
(character) allow easier tracking of messages produced |
debug |
(logical) additional messages for debugging |
This function returns a character vector formated as equal number of characters per value
equLenNumber(c(12,-3,321)) equLenNumber(c(12,-3.3,321))equLenNumber(c(12,-3,321)) equLenNumber(c(12,-3.3,321))
This function aims to identify extreme values (values most distant to mean, thus potential outlyers), mark them as NA or directely exclude them (depending on 'showNAs').
Note that every set of non-identical values will have at least one most extreme value. Extreme values are part of many distributions, they are not necessarily true outliers.
exclExtrValues( dat, result = "val", CVlim = NULL, maxExcl = 1, showNA = FALSE, goodValues = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )exclExtrValues( dat, result = "val", CVlim = NULL, maxExcl = 1, showNA = FALSE, goodValues = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )
dat |
numeric vector, main input |
result |
(character) may be 'val' for returning data without extreme values or 'pos' for returning position/index of extreme values |
CVlim |
(NULL or numeric) allows to retain extreme values only if a certain CV (for all 'dat') is exceeded (to avoid calling extreme values form homogenous data-sets) |
maxExcl |
(integer) max number of elments to explude |
showNA |
(logical) will display extrelme values as NA |
goodValues |
(logical) allows to display rather the good values instead of the extreme values |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns a numeric vector without extreme values or index-position of extreme values
firstOfRepLines, get1stOfRepeatedByCol for treatment of matrix
x <- c(rnorm(30),-6,20) exclExtrValues(x)x <- c(rnorm(30),-6,20) exclExtrValues(x)
This function normalizes 'dat' by optimizing exponent function (ie dat ^exp) to fit best to 'ref' (default: average of each line of 'dat').
exponNormalize( dat, useExpon, dynExp = TRUE, nStep = 20, startExp = 1, simMeas = "cor", refDat = NULL, refGrp = NULL, refLines = NULL, rSquare = FALSE, silent = FALSE, callFrom = NULL, debug = FALSE )exponNormalize( dat, useExpon, dynExp = TRUE, nStep = 20, startExp = 1, simMeas = "cor", refDat = NULL, refGrp = NULL, refLines = NULL, rSquare = FALSE, silent = FALSE, callFrom = NULL, debug = FALSE )
dat |
matrix or data.frame of numeric data to be normalized |
useExpon |
(numeric vector or matrix) exponent values to be tested |
dynExp |
(logical) require 'useExpon' as 2 values (matrix), will gradually increase exponent from 1st to 2nd; may be matrix or data.frame for dynamic, in this case 1st line for exp for lowest data, 2nd line for highest |
nStep |
(integer) number of exponent variations (steps) when testing range from-to |
startExp |
(numeric) |
simMeas |
(character) similarity metric to be used (so far only "cor"), if rSquare=TRRUE, the r-squared will be returned |
refDat |
(matrix or data.frame) if null average of each line from 'dat' will be used as reference in similarity measure |
refGrp |
(factor) designing which col of 'ref' should be used with which col of 'dat' (length equal to number of cols in 'dat'). Note: 'refGrp' not yet coded optimally to extract numeric part of character vector, protential problems when all lines or cols of dat are NA |
refLines |
(NULL or integer) optional subset of lines to be considered (only) when determining normalization factors |
rSquare |
(logical) if |
silent |
(logical) suppress messages |
callFrom |
(character) allows easier tracking of messages produced |
debug |
(logical) additional messages for debugging |
This function returns a matrix of normalized data
more eveolved than normalizeThis with arugment set to 'exponent'
set.seed(2016); dat1 <- matrix(c(runif(200)+rep(1:10,20)),nc=10) head(rowGrpCV(dat1,gr=gl(4,3,labels=LETTERS[1:4])[2:11])) set.seed(2016); dat1 <- c(0.1,0.2,0.3,0.5)*rep(c(1,10),each=4) dat1 <- matrix(round(c(sqrt(dat1),dat1^1.5,3*dat1+runif(length(dat1))),2),nc=3) dat2a <- exponNormalize(dat1[,1],useExpon=2,nSte=1,refD=dat1[,3]) layout(matrix(1:2,nc=2)) plot(dat1[,1],dat1[,3],type="b",main="init",ylab="ref") plot(dat2a$datNor[,1],dat1[,3],type="b",main="norm",ylab="ref") dat2b <- exponNormalize(dat1[,1],useExpon=c(1.7,2.3),nSte=5,refD=dat1[,3]) plot(dat1[,1],dat1[,3],type="b",main="init",ylab="ref") plot(dat2b$datNor[,1],dat1[,3],type="b",main="norm",ylab="ref") dat2c <- exponNormalize(dat1[,-3],useExpon=matrix(c(1.7,2.3,0.6,0.8),nc=2),nSte=5,refD=dat1[,3]); plot(dat1[,1],dat1[,3],type="b",main="init",ylab="ref ") plot(dat2c$datNor[,1],dat1[,3],type="b",main="norm 1",ylab="ref") plot(dat1[,2],dat1[,3],type="b",main="init",ylab="ref") plot(dat2c$datNor[,2],dat1[,3],type="b",main="norm 2",ylab="ref");set.seed(2016); dat1 <- matrix(c(runif(200)+rep(1:10,20)),nc=10) head(rowGrpCV(dat1,gr=gl(4,3,labels=LETTERS[1:4])[2:11])) set.seed(2016); dat1 <- c(0.1,0.2,0.3,0.5)*rep(c(1,10),each=4) dat1 <- matrix(round(c(sqrt(dat1),dat1^1.5,3*dat1+runif(length(dat1))),2),nc=3) dat2a <- exponNormalize(dat1[,1],useExpon=2,nSte=1,refD=dat1[,3]) layout(matrix(1:2,nc=2)) plot(dat1[,1],dat1[,3],type="b",main="init",ylab="ref") plot(dat2a$datNor[,1],dat1[,3],type="b",main="norm",ylab="ref") dat2b <- exponNormalize(dat1[,1],useExpon=c(1.7,2.3),nSte=5,refD=dat1[,3]) plot(dat1[,1],dat1[,3],type="b",main="init",ylab="ref") plot(dat2b$datNor[,1],dat1[,3],type="b",main="norm",ylab="ref") dat2c <- exponNormalize(dat1[,-3],useExpon=matrix(c(1.7,2.3,0.6,0.8),nc=2),nSte=5,refD=dat1[,3]); plot(dat1[,1],dat1[,3],type="b",main="init",ylab="ref ") plot(dat2c$datNor[,1],dat1[,3],type="b",main="norm 1",ylab="ref") plot(dat1[,2],dat1[,3],type="b",main="init",ylab="ref") plot(dat2c$datNor[,2],dat1[,3],type="b",main="norm 2",ylab="ref");
This function was designed for handeling measurements stored as list of multiple arrays, like eg compound-screens using microtiter-plates where multiple parameters ('channels') were recorded for each well (element). The elements (eg compounds screened) are typcally stored in the 1st dimension of the arrays, the replicated in the secon dimension and different measure types/parameters in the 3rd chanel. In order to keep the structure of of individual microtiter-plates, typically each plate forms a separate array (of same dimensions) in a list. The this function allows extracting a single channel of the list of arrays (3rd dim of each array) and return row-appended matrix.
extr1chan( arrLst, cha, na.rm = TRUE, rowSep = "__", silent = FALSE, debug = FALSE, callFrom = NULL )extr1chan( arrLst, cha, na.rm = TRUE, rowSep = "__", silent = FALSE, debug = FALSE, callFrom = NULL )
arrLst |
(list) list of arrays (typically 1st and 2nd dim for specific genes/objects, 3rd for different measures associated with) |
cha |
(integer) channel number |
na.rm |
(logical) default =TRUE to remove NAs |
rowSep |
(character) separator for rows |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
This function returns a list with just single channel extracted
arr1 <- array(1:24,dim=c(4,3,2),dimnames=list(c(LETTERS[1:4]), paste("col",1:3,sep=""),c("ch1","ch2"))) arr2 <- array(74:51,dim=c(4,3,2),dimnames=list(c(LETTERS[1:4]), paste("col",1:3,sep=""),c("ch1","ch2"))) arrL1 <- list(pl1=arr1,pl2=arr2) extr1chan(arrL1,ch=2)arr1 <- array(1:24,dim=c(4,3,2),dimnames=list(c(LETTERS[1:4]), paste("col",1:3,sep=""),c("ch1","ch2"))) arr2 <- array(74:51,dim=c(4,3,2),dimnames=list(c(LETTERS[1:4]), paste("col",1:3,sep=""),c("ch1","ch2"))) arrL1 <- list(pl1=arr1,pl2=arr2) extr1chan(arrL1,ch=2)
This function extracts last 2 (integer) numeric parts between punctuations out of character vector 'x'.
Runs faster than gregexpr .
Note: won't work correctly with decimals or exponential signs !! (such characters will be considered as punctuation, ie as separator)
extractLast2numericParts(x, silent = FALSE, debug = FALSE, callFrom = NULL)extractLast2numericParts(x, silent = FALSE, debug = FALSE, callFrom = NULL)
x |
main character input |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns a (numeric) matrix with 2 columns (eg from initial concatenated coordinates)
gregexpr from grep
extractLast2numericParts(c("M01.1-4","M001/2.5","M_0001_03-16","zyx","012","a1.b2.3-7,2"))extractLast2numericParts(c("M01.1-4","M001/2.5","M_0001_03-16","zyx","012","a1.b2.3-7,2"))
This function provides flexible checking if a set of columns may be extracted from a matrix or data.frame 'x'.
If argument extrCol is list of character vectors, this allows to search among given options, the first matching name for each vector will be identified.
extrColsDeX(x, extrCol, doExtractCols = FALSE, callFrom = NULL, silent = FALSE)extrColsDeX(x, extrCol, doExtractCols = FALSE, callFrom = NULL, silent = FALSE)
x |
(matrix or data.frame) main input (where data should be extracted from) |
extrCol |
(character, integer or list) columns to be extracted, may be column-names or column index; if is |
doExtractCols |
(logical) if default |
callFrom |
(character) allows easier tracking of message(s) produced |
silent |
(logical) suppress messages |
integer-vector (ifdoExtractCols=FALSE return depending on input matrix or data.frame)
dFr <- data.frame(a=11:14, b=24:21, cc=LETTERS[1:4], dd=rep(c(TRUE,FALSE),2)) extrColsDeX(dFr,c("b","cc","notThere")) extrColsDeX(dFr,c("b","cc","notThere"), doExtractCols=TRUE) extrColsDeX(dFr, list(c("nn","b","a"), c("cc","a"),"notThere"))dFr <- data.frame(a=11:14, b=24:21, cc=LETTERS[1:4], dd=rep(c(TRUE,FALSE),2)) extrColsDeX(dFr,c("b","cc","notThere")) extrColsDeX(dFr,c("b","cc","notThere"), doExtractCols=TRUE) extrColsDeX(dFr, list(c("nn","b","a"), c("cc","a"),"notThere"))
This function extracts numeric part of matrix or data.frame, removing remaining non-numeric elements if trimToData is set to TRUE.
Note, that cropping entire lines where a (single) text element appeared may quickly reduce the overal content of the input data.
extrNumericFromMatr( dat, trimToData = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )extrNumericFromMatr( dat, trimToData = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )
dat |
matrix (or data.frame) for extracting numeric parts |
trimToData |
(logical) default to remove (crop) lines and cols contributing to NA, non-numeric data is transfomed to NA |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of message(s) produced |
This function reurns a matrix of numeric data
mat <- matrix(c(letters[1:7],14:16,LETTERS[1:6]),nrow=4,dimnames=list(1:4,letters[1:4])) mat; extrNumericFromMatr(mat) mat <- matrix(c(letters[1:4],1,"e",12:19,LETTERS[1:6]),nr=5,dimnames=list(11:15,letters[1:4])) mat; extrNumericFromMatr(mat)mat <- matrix(c(letters[1:7],14:16,LETTERS[1:6]),nrow=4,dimnames=list(1:4,letters[1:4])) mat; extrNumericFromMatr(mat) mat <- matrix(c(letters[1:4],1,"e",12:19,LETTERS[1:6]),nr=5,dimnames=list(11:15,letters[1:4])) mat; extrNumericFromMatr(mat)
This function extracts/cuts text-fragments out of txt following specific anchors defined by arguments cutFrom and cutTo.
extrSpcText( txt, cutFrom = " GN=", cutTo = " PE=", missingAs = NA, exclFromTag = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )extrSpcText( txt, cutFrom = " GN=", cutTo = " PE=", missingAs = NA, exclFromTag = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )
txt |
character vector to be treated |
cutFrom |
(character) text where to start cutting |
cutTo |
(character) text where to stop cutting |
missingAs |
(character) specific content of output at line/location of 'exclLi' |
exclFromTag |
(logical) to exclude text given in 'cutFrom' from result |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
In case cutFrom is not found missingAs will be returned.
In case cutTo is not found, text gets extracted with chaMaxEl characters.
This function returns a modified character vector
extrSpcText(c(" ghjg GN=thisText PE=001"," GN=_ PE=", NA, "abcd")) extrSpcText(c("ABCDEF.3-6","05g","bc.4-5"), cutFr="\\.", cutT="-")extrSpcText(c(" ghjg GN=thisText PE=001"," GN=_ PE=", NA, "abcd")) extrSpcText(c("ABCDEF.3-6","05g","bc.4-5"), cutFr="\\.", cutT="-")
Filtering of matrix or (3-dim) array x : filter column according to filtCrit (eg 'inf') and threshold filtVal
filt3dimArr( x, filtVal, filtTy = ">", filtCrit = NULL, displCrit = NULL, silent = FALSE, debug = FALSE, callFrom = NULL )filt3dimArr( x, filtVal, filtTy = ">", filtCrit = NULL, displCrit = NULL, silent = FALSE, debug = FALSE, callFrom = NULL )
x |
array (3-dim) of numeric data |
filtVal |
(numeric, length=1) for testing inferior/superor/equal condition |
filtTy |
(character, length=1) which type of testing to perform (may be 'eq','inf','infeq','sup','supeq', '>', '<', '>=', '<=', '==') |
filtCrit |
(character, length=1) which column-name consider when filtering filter with 'filtVal' and 'filtTy' |
displCrit |
(character) column-name(s) to display |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
and extract/display all col matching 'displCrit'.
This function returns a list of filtered matrixes (by 3rd dim)
filterList; filterLiColDeList;
arr1 <- array(11:34, dim=c(4,3,2), dimnames=list(c(LETTERS[1:4]), paste("col",1:3,sep=""), c("ch1","ch2"))) filt3dimArr(arr1,displCrit=c("col1","col2"),filtCrit="col2",filtVal=7)arr1 <- array(11:34, dim=c(4,3,2), dimnames=list(c(LETTERS[1:4]), paste("col",1:3,sep=""), c("ch1","ch2"))) filt3dimArr(arr1,displCrit=c("col1","col2"),filtCrit="col2",filtVal=7)
Filter all elements of list (or S3-object) according to criteria designed to one selected reference-element of the list. All simple vectors, matrix, data.frames and 3-dimensional arrays will be checked if matching number of rows and/or columns to decide if they should be filtered the same way. If the reference element has same number of rows and columns simple (1-dimensional) vectors won't be filtered since it not clear if this should be done to lines or columns.
filterLiColDeList( lst, useLines, useCols = NULL, ref = 1, silent = FALSE, callFrom = NULL, debug = FALSE )filterLiColDeList( lst, useLines, useCols = NULL, ref = 1, silent = FALSE, callFrom = NULL, debug = FALSE )
lst |
(list or S3 object) main input |
useLines |
(integer, logcial or character) vector to assign lines to keep when filtering along lines;
set to |
useCols |
(integer, logcial or character) vector for filtering columns; set to |
ref |
(integer) index for designing the elment of 'lst' to take as reference for checking which other list-elements have suitable number of rows or columns |
silent |
(logical) suppress messages |
callFrom |
(character) allow easier tracking of messages produced |
debug |
(logical) additional messages for debugging |
This function is used eg in package wrProteo to simultaneaously filter raw and transformed data.
This function returns the correct(ed) input (object of same class, of same length)
moderTest2grp for single comparisons, lmFit
lst1 <- list(m1=matrix(11:18,ncol=2), m2=matrix(21:30,ncol=2), indR=31:34, m3=matrix(c(21:23,NA,25:27,NA),ncol=2)) ## here $m2 has more lines than $m1, and thus will be ignored when ref=1 filterLiColDeList(lst1, useLines=2:3) filterLiColDeList(lst1, useLines="allNA", ref=4)lst1 <- list(m1=matrix(11:18,ncol=2), m2=matrix(21:30,ncol=2), indR=31:34, m3=matrix(c(21:23,NA,25:27,NA),ncol=2)) ## here $m2 has more lines than $m1, and thus will be ignored when ref=1 filterLiColDeList(lst1, useLines=2:3) filterLiColDeList(lst1, useLines="allNA", ref=4)
This function aims to apply a given filter-citerium, a matrix or vector of FALSE/TRUE which is typically combined with a second layer
which filters for a min content of filer-passing values per line for the first/main criterium.
Then all lines concerned will be removed. This will be done for all list-elements (of appropriate size) of the input-list
(while maintaining the list-structure in the output) not matching the filtering criteria.
filterList(lst, filt, minLineRatio = 0.5, silent = FALSE, callFrom = NULL)filterList(lst, filt, minLineRatio = 0.5, silent = FALSE, callFrom = NULL)
lst |
(list) main input, each vector, matrix or data.frame in this list will be filtered if its length or number of lines fits to |
filt |
(logical) vector of |
minLineRatio |
(numeric) in case |
silent |
(logical) suppress messages |
callFrom |
(character) allow easier tracking of message(s) produced |
filtered list
correctToUnique, unique, duplicated, extrColsDeX
set.seed(2020); dat1 <- round(runif(80),2) list1 <- list(m1=matrix(dat1[1:40],ncol=8), m2=matrix(dat1[41:80],ncol=8), other=letters[1:8]) rownames(list1$m1) <- rownames(list1$m2) <- paste0("line",1:5) filterList(list1, list1$m1[,1] >0.4) filterList(list1, list1$m1 >0.4)set.seed(2020); dat1 <- round(runif(80),2) list1 <- list(m1=matrix(dat1[1:40],ncol=8), m2=matrix(dat1[41:80],ncol=8), other=letters[1:8]) rownames(list1$m1) <- rownames(list1$m2) <- paste0("line",1:5) filterList(list1, list1$m1[,1] >0.4) filterList(list1, list1$m1 >0.4)
limInt) and add sandwich-nodes (nodes inter-connecting initial nodes) out of node-based queries.Filter nodes & edges for extracting networks
This function allows extracting and filtering network-data based on fixed threshold (limInt) and add sandwich-nodes (nodes inter-connecting initial nodes) out of node-based queries.
filterNetw( lst, filtCol = 3, limInt = 5000, sandwLim = 5000, filterAsInf = TRUE, outFormat = "matrix", remOrphans = TRUE, remRevPairs = TRUE, elemNa = "genes", silent = FALSE, callFrom = NULL, debug = FALSE )filterNetw( lst, filtCol = 3, limInt = 5000, sandwLim = 5000, filterAsInf = TRUE, outFormat = "matrix", remOrphans = TRUE, remRevPairs = TRUE, elemNa = "genes", silent = FALSE, callFrom = NULL, debug = FALSE )
lst |
(list, composed of multiple matrix or data.frames ) main input (each list-element should have same number of columns) |
filtCol |
(integer, length=1) which column of |
limInt |
(numeric, length=1) filter main edge-scores according to |
sandwLim |
(numeric, length=1) filter sandwich connection edge-scores accodring to |
filterAsInf |
(logical) filter as 'inferior or equal' or 'superior or equal' |
outFormat |
(character) may be 'matrix' for tabular output, 'all' as list with matrix and list of node-names |
remOrphans |
(logical) remove networks consisting only of 2 connected edges |
remRevPairs |
(logical) remove duplicate edges due to reverse massping (eg A - B and B - A); NOTE : use only when edges don't have orientation ! |
elemNa |
(character) used only for messages |
silent |
(logical) suppress messages |
callFrom |
(character) allow easier tracking of message(s) produced |
debug |
(logical) display additional messages for debugging |
This function returns a matrix or data.frame
in cbind
lst2 <- list('121'=data.frame(ID=as.character(c(141,221,228,229,449)),11:15), '131'=data.frame(ID=as.character(c(228,331,332,333,339)),11:15), '141'=data.frame(ID=as.character(c(121,151,229,339,441,442,449)),c(11:17)), '151'=data.frame(ID=as.character(c(449,141,551,552)),11:14), '161'=data.frame(ID=as.character(171),11), '171'=data.frame(ID=as.character(161),11), '181'=data.frame(ID=as.character(881:882),11:12) ) lst2 <- list('121'=data.frame(ID=as.character(c(141,221,228,229,449)),11:15, 21:25), '131'=data.frame(ID=as.character(c(228,331,332,333,339)),11:15, 21:25), '141'=data.frame(ID=as.character(c(121,151,229,339,441,442,449)), c(11:17), 21:27), '151'=data.frame(ID=as.character(c(449,141,551,552)), 11:14, 21:24), '161'=data.frame(ID=as.character(171), 11,21), '171'=data.frame(ID=as.character(161), 11,21), '181'=data.frame(ID=as.character(881:882), 11:12,21:22) ) (te1 <- filterNetw(lst2, limInt=90, remOrphans=FALSE)) (te2 <- filterNetw(lst2, limInt=90, remOrphans=TRUE)) (te3 <- filterNetw(lst2, limInt=13, remOrphans=FALSE)) (te4 <- filterNetw(lst2, limInt=13, remOrphans=TRUE))lst2 <- list('121'=data.frame(ID=as.character(c(141,221,228,229,449)),11:15), '131'=data.frame(ID=as.character(c(228,331,332,333,339)),11:15), '141'=data.frame(ID=as.character(c(121,151,229,339,441,442,449)),c(11:17)), '151'=data.frame(ID=as.character(c(449,141,551,552)),11:14), '161'=data.frame(ID=as.character(171),11), '171'=data.frame(ID=as.character(161),11), '181'=data.frame(ID=as.character(881:882),11:12) ) lst2 <- list('121'=data.frame(ID=as.character(c(141,221,228,229,449)),11:15, 21:25), '131'=data.frame(ID=as.character(c(228,331,332,333,339)),11:15, 21:25), '141'=data.frame(ID=as.character(c(121,151,229,339,441,442,449)), c(11:17), 21:27), '151'=data.frame(ID=as.character(c(449,141,551,552)), 11:14, 21:24), '161'=data.frame(ID=as.character(171), 11,21), '171'=data.frame(ID=as.character(161), 11,21), '181'=data.frame(ID=as.character(881:882), 11:12,21:22) ) (te1 <- filterNetw(lst2, limInt=90, remOrphans=FALSE)) (te2 <- filterNetw(lst2, limInt=90, remOrphans=TRUE)) (te3 <- filterNetw(lst2, limInt=13, remOrphans=FALSE)) (te4 <- filterNetw(lst2, limInt=13, remOrphans=TRUE))
This function aims to identify and remove duplicated elements in a list and maintain the list-structure in the output.
filtSizeUniq filters 'lst' (list of character-vectors or character-vector) for elements being unique (to 'ref' or if NULL to all 'lst') and of character length.
In addition, the min- and max- character length may be filtered, too. Eg, in proteomics this helps removing peptide sequences which would not be measured/detected any way.
filtSizeUniq( lst, ref = NULL, minSize = 6, maxSize = 36, filtUnique = TRUE, byProt = TRUE, inclEmpty = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )filtSizeUniq( lst, ref = NULL, minSize = 6, maxSize = 36, filtUnique = TRUE, byProt = TRUE, inclEmpty = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )
lst |
list of character-vectors or character-vector |
ref |
(character) optional alternative 'reference', if not |
minSize |
(integer) minimum number of characters, if |
maxSize |
(integer) maximum number of characters |
filtUnique |
(logical) if |
byProt |
(logical) if |
inclEmpty |
(logical) optional including empty list-elements when all elements have been filtered away - if 'lst' was named list |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
list of filtered input
correctToUnique, unique, duplicated
filtSizeUniq(list(A="a",B=c("b","bb","c"),D=c("dd","d","ddd","c")),filtUn=TRUE,minSi=NULL) # input: c and dd are repeated filtSizeUniq(list(A="a",B=c("b","bb","c"),D=c("dd","d","ddd","c")),ref=c(letters[c(1:26,1:3)], "dd","dd","bb","ddd"),filtUn=TRUE,minSi=NULL) # a,b,c,dd repeatedfiltSizeUniq(list(A="a",B=c("b","bb","c"),D=c("dd","d","ddd","c")),filtUn=TRUE,minSi=NULL) # input: c and dd are repeated filtSizeUniq(list(A="a",B=c("b","bb","c"),D=c("dd","d","ddd","c")),ref=c(letters[c(1:26,1:3)], "dd","dd","bb","ddd"),filtUn=TRUE,minSi=NULL) # a,b,c,dd repeated
findCloseMatch finds close matches (similar values) between two numeric vectors ('x','y') based on method 'compTy' and threshold 'limit'.
Return list with close matches of 'x' to given 'y', the numeric value dependes on 'sortMatch' (if FALSE then always value of 'y' otherwise of longest of x&y).
Note: Speed & memory improvement if 'sortMatch'=TRUE (but result might be inversed!): adopt search of x->y or y->x to searching matches of each longest to each shorter (ie flip x &y).
Otherwise, if length of 'x' & 'y' are very different, it may be advantagous to use a long(er) 'x' and short(er) 'y' (with 'sortMatch'=FALSE).
Note: Names of 'x' & 'y' or (if no names) prefix letters 'x' & 'y' are always added as names to results.
findCloseMatch( x, y, compTy = "ppm", limit = 5, asIndex = FALSE, maxFitShort = 100, sortMatch = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )findCloseMatch( x, y, compTy = "ppm", limit = 5, asIndex = FALSE, maxFitShort = 100, sortMatch = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )
x |
numeric vector for comparison |
y |
numeric vector for comparison |
compTy |
(character) may be 'diff' or 'ppm', will be used with threshold from argument 'limit' |
limit |
(numeric) threshold value for retaining values, used with distace-type specified in argument 'compTy' |
asIndex |
(logical) optionally rather report index of retained values |
maxFitShort |
(numeric) limit output to max number of elements (avoid returning high number of results if filtering was not enough stringent) |
sortMatch |
(logical) if TRUE than matching will be preformed as 'match longer (of x & y) to closer', this may process slightly faster (eg 'x' longer: list for each 'y' all 'x' that are close, otherwise list of each 'x'), |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns a list with close matches of 'x' to given 'y', the numeric value dependes on 'sortMatch' (if FASLE then always value of 'y' otherwise of longest of x&y)
checkSimValueInSer and (from this package) .compareByDiff, for convient output countCloseToLimits
aa <- 11:14 ; bb <- c(13.1,11.5,14.3,20:21) findCloseMatch(aa,bb,com="diff",lim=0.6) findCloseMatch(c(a=5,b=11,c=12,d=18),c(G=2,H=11,I=12,J=13)+0.5, comp="diff", lim=2) findCloseMatch(c(4,5,11,12,18),c(2,11,12,13,33)+0.5, comp="diff", lim=2) findCloseMatch(c(4,5,11,12,18),c(2,11,12,13,33)+0.5, comp="diff", lim=2, sort=FALSE) .compareByDiff(list(c(a=10,b=11,c=12,d=13),c(H=11,I=12,J=13,K=33)+0.5),limit=1) #' return matrix a2 <- c(11:20); names(a2) <- letters[11:20] b2 <- c(25:5)+c(rep(0,5),(1:10)/50000,rep(0,6)); names(b2) <- LETTERS[25:5] which(abs(b2-a2[8]) < a2[8]*1e-6*5) #' find R=18 : no10 findCloseMatch(a2, b2, com="ppm", lim=5) #' find Q,R,S,T findCloseMatch(a2, b2, com="ppm", lim=5,asI=TRUE) #' find Q,R,S,T findCloseMatch(b2, a2, com="ppm", lim=5,asI=TRUE,sort=FALSE) findCloseMatch(a2, b2, com="ratio", lim=1.000005) #' find Q,R,S,T findCloseMatch(a2, b2, com="diff", lim=0.00005) #' find S,Taa <- 11:14 ; bb <- c(13.1,11.5,14.3,20:21) findCloseMatch(aa,bb,com="diff",lim=0.6) findCloseMatch(c(a=5,b=11,c=12,d=18),c(G=2,H=11,I=12,J=13)+0.5, comp="diff", lim=2) findCloseMatch(c(4,5,11,12,18),c(2,11,12,13,33)+0.5, comp="diff", lim=2) findCloseMatch(c(4,5,11,12,18),c(2,11,12,13,33)+0.5, comp="diff", lim=2, sort=FALSE) .compareByDiff(list(c(a=10,b=11,c=12,d=13),c(H=11,I=12,J=13,K=33)+0.5),limit=1) #' return matrix a2 <- c(11:20); names(a2) <- letters[11:20] b2 <- c(25:5)+c(rep(0,5),(1:10)/50000,rep(0,6)); names(b2) <- LETTERS[25:5] which(abs(b2-a2[8]) < a2[8]*1e-6*5) #' find R=18 : no10 findCloseMatch(a2, b2, com="ppm", lim=5) #' find Q,R,S,T findCloseMatch(a2, b2, com="ppm", lim=5,asI=TRUE) #' find Q,R,S,T findCloseMatch(b2, a2, com="ppm", lim=5,asI=TRUE,sort=FALSE) findCloseMatch(a2, b2, com="ratio", lim=1.000005) #' find Q,R,S,T findCloseMatch(a2, b2, com="diff", lim=0.00005) #' find S,T
This function allows mapping which group-names are occuring either as head or as tail in pairwise combined terms (by checking from tails).
findHeadAndTail( grpNa, pairwNa, reportAs = "list", sortGrp = TRUE, rmAmbig = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )findHeadAndTail( grpNa, pairwNa, reportAs = "list", sortGrp = TRUE, rmAmbig = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )
grpNa |
(character) the names of the groups of replicates (ie conditions) used to test |
pairwNa |
(character) the names of pairwise-testing (ie 'concatenated' |
reportAs |
(character) default |
sortGrp |
(logical) by default groups will be sorted (as levels of a factor appear sorted) |
rmAmbig |
(logical) remove all ambiguous |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function aims identifying the separator used wo create pairwise comparison labels by looking for given group-names at head and tail of combined labels. If labeles occur inside oyther ones (eg 'AB' in 'ABC') it will always privilidge the longest one. After stripping off all group-names the remaining charachers are considered as the separator used. The function will also check if all pairwise labels returned the same separtator and in case of multiple separators found the most frequent may be reytained.
This function returns a list containing $sep a character vector of the separator(s) identified
(for running multiple pair-wise test) moderTestXgrp, used underneith grep
findHeadAndTail(LETTERS[4:2], c("D-X","D-C")) grp1 <- c("C","ACC","CC","B.B","B.BA","B","CA") pwNa1 <- "B.B-CC" findHeadAndTail(grp1, pwNa1) pwNa2 <- c("B.B-CC", "CA-ACC") findHeadAndTail(grp1, pwNa2)findHeadAndTail(LETTERS[4:2], c("D-X","D-C")) grp1 <- c("C","ACC","CC","B.B","B.BA","B","CA") pwNa1 <- "B.B-CC" findHeadAndTail(grp1, pwNa1) pwNa2 <- c("B.B-CC", "CA-ACC") findHeadAndTail(grp1, pwNa2)
This function gets index of repeated items/values in vector 'x' (will be treated as character).
It returns (named) list of indexes for each of the repeated values, or NULL if all values are unique.
This approach is similar but more basic compared to get1stOfRepeatedByCol.
findRepeated( x, nonRepeated = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )findRepeated( x, nonRepeated = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )
x |
character vector |
nonRepeated |
(logical) if |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns a (named) list of indexes for each of the repeated values, or NULL if all values unique
similar approach but more basic than get1stOfRepeatedByCol
aa <- c(11:16,14:12,14); findRepeated(aa)aa <- c(11:16,14:12,14); findRepeated(aa)
This function compares to vectors or matrixes and returns combined view including only all close (by findCloseMatch).
Return matrix (predMatr) with add'l columns for index to and 'grp' (group of similar values (1-to-many)), 'nGrp' (n of grp), 'isBest' or 'nBest', 'disToMeas'
(distance/difference between pair) & 'ppmToPred' (distance in ppm).
Note: too wide 'limitComp' will result in large window and many 'good' hits will compete (and be mutually exlcuded) if selection 'bestOnly' is selected
findSimilFrom2sets( predMatr, measMatr, colMeas = 1, colPre = 1, compareTy = "diff", limitComp = 0.5, bestOnly = FALSE, silent = FALSE, callFrom = NULL, debug = FALSE )findSimilFrom2sets( predMatr, measMatr, colMeas = 1, colPre = 1, compareTy = "diff", limitComp = 0.5, bestOnly = FALSE, silent = FALSE, callFrom = NULL, debug = FALSE )
predMatr |
(matrix or numeric vector) dataset number 1, referred to as 'predicted', the colum speified in argument |
measMatr |
(matrix or numeric vector) dataset number 2, referred to as 'measured', the colum speified in argument |
colMeas |
(integer) which column number of 'measMatr' to consider |
colPre |
(integer) which column number of 'predMatr' to consider |
compareTy |
(character) 'diff' (difference) 'ppm' (relative difference) |
limitComp |
(numeric) limit used by 'compareTy' |
bestOnly |
(logical) allows to filter only hits with min distance (defined by 'compareTy'), 3rd last col will be 'nBest' - otherwise 3rd last col 'isBest' |
silent |
(logical) suppress messages |
callFrom |
(character) allow easier tracking of messages produced |
debug |
(logical) for bug-tracking: more/enhanced messages |
This function returns a matrix (predMatr) with add'l columns for index to and 'grp' (group of similar values (1-to-many)), 'nGrp' (n of grp), 'isBest' or 'nBest', 'disToMeas' (distance/difference between pair) & 'ppmToPred' (distance in ppm)
checkSimValueInSer findCloseMatch closeMatchMatrix
aA <- c(11:17); bB <- c(12.001,13.999); cC <- c(16.2,8,9,12.5,12.6,15.9,14.1) aZ <- matrix(c(aA,aA+20),ncol=2,dimnames=list(letters[1:length(aA)],c("aaA","aZ"))) cZ <- matrix(c(cC,cC+20),ncol=2,dimnames=list(letters[1:length(cC)],c("ccC","cZ"))) findCloseMatch(cC,aA,com="diff",lim=0.5,sor=FALSE) findSimilFrom2sets(aA,cC) findSimilFrom2sets(cC,aA) findSimilFrom2sets(aA,cC,best=FALSE) findSimilFrom2sets(aA,cC,comp="ppm",lim=5e4,deb=TRUE) findSimilFrom2sets(aA,cC,comp="ppm",lim=9e4,bestO=FALSE) # below: find fewer 'best matches' since search window larger (ie more good hits compete !) findSimilFrom2sets(aA,cC,comp="ppm",lim=9e4,bestO=TRUE)aA <- c(11:17); bB <- c(12.001,13.999); cC <- c(16.2,8,9,12.5,12.6,15.9,14.1) aZ <- matrix(c(aA,aA+20),ncol=2,dimnames=list(letters[1:length(aA)],c("aaA","aZ"))) cZ <- matrix(c(cC,cC+20),ncol=2,dimnames=list(letters[1:length(cC)],c("ccC","cZ"))) findCloseMatch(cC,aA,com="diff",lim=0.5,sor=FALSE) findSimilFrom2sets(aA,cC) findSimilFrom2sets(cC,aA) findSimilFrom2sets(aA,cC,best=FALSE) findSimilFrom2sets(aA,cC,comp="ppm",lim=5e4,deb=TRUE) findSimilFrom2sets(aA,cC,comp="ppm",lim=9e4,bestO=FALSE) # below: find fewer 'best matches' since search window larger (ie more good hits compete !) findSimilFrom2sets(aA,cC,comp="ppm",lim=9e4,bestO=TRUE)
This function aims to help finding stretches/segments of data with a given maximum number of NA-instances.
findUsableGroupRange( dat, grp, maxNA = 1, silent = FALSE, debug = FALSE, callFrom = NULL )findUsableGroupRange( dat, grp, maxNA = 1, silent = FALSE, debug = FALSE, callFrom = NULL )
dat |
(matrix or data.frame) main input |
grp |
(factor) information which column of 'dat' is replicate of whom |
maxNA |
(interger) max number of tolerated NAs |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
To find groups within a specific range, this function searches independently each line of the input-matrix 'dat' for sretches with a given maximum of NA-instances ('maxNA').
This function is used to inspect/filter each lines of 'dat' for a subset with sufficient presence/absence of NA values (ie limit number of NAs per level of 'grp').
Note : optimal perfomance with n.lines >> n.groups
This function returns a matrix with boundaries of 1st and last usable column (NA if there were no suitable groups found)
dat1 <- matrix(1:56, ncol=7) dat1[c(2,3,4,5,6,10,12,18,19,20,22,23,26,27,28,30,31,34,38,39,50,54)] <- NA rownames(dat1) <- letters[1:nrow(dat1)] findUsableGroupRange(dat1, gl(3,3)[-(3:4)])dat1 <- matrix(1:56, ncol=7) dat1[c(2,3,4,5,6,10,12,18,19,20,22,23,26,27,28,30,31,34,38,39,50,54)] <- NA rownames(dat1) <- letters[1:nrow(dat1)] findUsableGroupRange(dat1, gl(3,3)[-(3:4)])
This function aims to reduce the complexity of a matrix (or data.frame) in case column 'refCol' has multiple lines with same value.
In this case, it reduces the input-data to 1st line of redundant entries and returns a matrix (or data.frame) without lines identified as redundant entries for 'refCol').
in sum, this functions works lile useng unique on a given column, and propagates the same treatment to all other columns.
firstLineOfDat(dat, refCol = 2, silent = FALSE, debug = FALSE, callFrom = NULL)firstLineOfDat(dat, refCol = 2, silent = FALSE, debug = FALSE, callFrom = NULL)
dat |
(matrix or data.frame) main input |
refCol |
(integer) column number of reference-column |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
matrix (same number of columns as input)
firstOfRepeated, unique, duplicated
(mat1 <- matrix(c(1:6,rep(1:3,1:3)),ncol=2,dimnames=list(letters[1:6],LETTERS[1:2]))) firstLineOfDat(mat1)(mat1 <- matrix(c(1:6,rep(1:3,1:3)),ncol=2,dimnames=list(letters[1:6],LETTERS[1:2]))) firstLineOfDat(mat1)
This function works similar to unique, but provides additional information about which elements of original input 'x' are repeatd by providing indexes realtoe to the input.
firstOfRepeated makes list with 3 elements : $indRepeated.. index for first of repeated 'x', $indUniq.. index of all unique + first of repeated, $indRedund.. index of all redundant entries, ie non-unique (wo 1st).
Used for reducing data to non-redundant status, however, for large numeric input the function nonAmbiguousNum() may perform better/faster.
NAs won't be considered (NAs do not appear in reported index of results), see also firstOfRepLines() .
firstOfRepeated(x, silent = FALSE, debug = FALSE, callFrom = NULL)firstOfRepeated(x, silent = FALSE, debug = FALSE, callFrom = NULL)
x |
(charcter or numeric) main input |
silent |
(logical) suppress messages |
debug |
(logical) display additional messages for debugging |
callFrom |
(character) allow easier tracking of message(s) produced |
list with indices: $indRepeated, $indUniq, $indRedund
duplicated, nonAmbiguousNum, firstOfRepLines gives less detail in output (lines/elements/indexes of omitted not directly accessible) and works fsster
x <- c(letters[c(3,2:4,8,NA,3:1,NA,5:4)]); names(x) <- 100+(1:length(x)) firstOfRepeated(x) x[firstOfRepeated(x)$indUniq] # only unique with namesx <- c(letters[c(3,2:4,8,NA,3:1,NA,5:4)]); names(x) <- 100+(1:length(x)) firstOfRepeated(x) x[firstOfRepeated(x)$indUniq] # only unique with names
This function concatenattes all columns of input-matrix and then searches like unique for unique elements, optionally the indexes of unique elements may get returned.
Note: This function reats input as character (thus won't understand 10==10.0 ).
Returns simplified/non-redundant vector/matrix (ie fewer lines), or respective index.
faster than firstOfRepeated
firstOfRepLines( mat, outTy = "ind", useCol = NULL, silent = FALSE, debug = FALSE, callFrom = NULL )firstOfRepLines( mat, outTy = "ind", useCol = NULL, silent = FALSE, debug = FALSE, callFrom = NULL )
mat |
initial matrix to treat |
outTy |
for output type: 'ind'.. index to 1st occurance (non-red),'orig'..non-red lines of mat, 'conc'.. non-red concateneted values, 'num'.. index to which group/category the lines belong |
useCol |
(integer) custom choice of which columns to paste/concatenate |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns a simplified/non-redundant vector/matrix (ie fewer lines for matrix), or respective index
unique, nonAmbiguousNum, faster than firstOfRepeated which gives more detail in output (lines/elements/indexes of omitted)
mat <- matrix(c("e","n","a","n","z","z","n","z","z","b", "","n","c","n","","","n","","","z"),ncol=2) firstOfRepLines(mat,out="conc")mat <- matrix(c("e","n","a","n","z","z","n","z","z","b", "","n","c","n","","","n","","","z"),ncol=2) firstOfRepLines(mat,out="conc")
In a number of instances experimental measurements and additional information (annotation) are provided by separate objects (matrixes) as they may not be generated the same time.
The aim of this function is provide help when matching approprate lines for 2 sets of data (experimental measures in iniTab and annotation from annotTab) for fusing.
fuseAnnotMatr adds suppelmental columns/annotation to an initial matrix iniTab : using column 'refIniT' as key (in iniTab) to compare with key 'refAnnotT' (from 'annotTab').
The columns to be added from annotTab must be chosen explicitely.
Note: if non-unique IDs in iniTab : runs slow (but save) due to use of loop for each unique ID.
fuseAnnotMatr( iniTab, annotTab, refIniT = "Uniprot", refAnnotT = "combName", addCol = c("ensembl_gene_id", "description", "geneName", "combName"), debug = TRUE, silent = FALSE, callFrom = NULL )fuseAnnotMatr( iniTab, annotTab, refIniT = "Uniprot", refAnnotT = "combName", addCol = c("ensembl_gene_id", "description", "geneName", "combName"), debug = TRUE, silent = FALSE, callFrom = NULL )
iniTab |
(matrix), that may have lines with multiple (=repeated) key entries |
annotTab |
(matrix) containing reference annotation |
refIniT |
(character) type of reference (eg 'Uniprot') |
refAnnotT |
(character) column name to use for reference-annotation |
addCol |
(character) column-namess of 'annotTab' to use/extract (if no matches found, use all) |
debug |
(logical) for bug-tracking: more/enhanced messages |
silent |
(logical) suppress messages |
callFrom |
(character) allow easier tracking of message(s) produced |
This function returns a combined matrix (elements not found in 'annotTab' are displayed as NA)
tab0 <- matrix(rep(letters[1:25],8),ncol=10) tab1 <- cbind(Uniprot=paste(tab0[,1],tab0[,2]),col1=paste(tab0[,3], tab0[,4],tab0[,5]," ",tab0[,7],tab0[,6])) tab2 <- cbind(combName=paste(tab0[,1],tab0[,2]),col2=paste(tab0[,8],tab0[,9],tab0[,10])) fuseAnnotMatr(tab1,tab2[c(20:11,2:5),],refIni="Uniprot",refAnnotT="combName",addCol="col2") fuseAnnotMatr(tab2[c(20:11,2:5),],tab1,refAnnotT="Uniprot",refIni="combName",addCol="col1")tab0 <- matrix(rep(letters[1:25],8),ncol=10) tab1 <- cbind(Uniprot=paste(tab0[,1],tab0[,2]),col1=paste(tab0[,3], tab0[,4],tab0[,5]," ",tab0[,7],tab0[,6])) tab2 <- cbind(combName=paste(tab0[,1],tab0[,2]),col2=paste(tab0[,8],tab0[,9],tab0[,10])) fuseAnnotMatr(tab1,tab2[c(20:11,2:5),],refIni="Uniprot",refAnnotT="combName",addCol="col2") fuseAnnotMatr(tab2[c(20:11,2:5),],tab1,refAnnotT="Uniprot",refIni="combName",addCol="col1")
This function fuses (character or numeric) elements of list re-occuring under same name, so that resultant list has unique names. Note : Will not work with list of matrixes
fuseCommonListElem( lst, initOrd = TRUE, removeDuplicates = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )fuseCommonListElem( lst, initOrd = TRUE, removeDuplicates = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )
lst |
(list) main input, list of numeric vectors |
initOrd |
(logical) preserve initial order in output (if TRUE) or otherwise sort alphabetically |
removeDuplicates |
(logical) allow to remove duplicate entries (if vector contains names, both the name and the value need to be identical to be removed; note: all names must have names with more than 0 characters to be considered as names) |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns a fused list (same names as elements of input)
val1 <- 10 +1:26 names(val1) <- letters lst1 <- list(c=val1[3:6],a=val1[1:3],b=val1[2:3],a=val1[12],c=val1[13]) fuseCommonListElem(lst1)val1 <- 10 +1:26 names(val1) <- letters lst1 <- list(c=val1[3:6],a=val1[1:3],b=val1[2:3],a=val1[12],c=val1[13]) fuseCommonListElem(lst1)
Fuse previously identified pairs to 'clusters', return vector with cluster-numbers.
fusePairs( datPair, refDatNames = NULL, inclRepLst = FALSE, maxFuse = NULL, debug = FALSE, silent = TRUE, callFrom = NULL )fusePairs( datPair, refDatNames = NULL, inclRepLst = FALSE, maxFuse = NULL, debug = FALSE, silent = TRUE, callFrom = NULL )
datPair |
2-column matrix where each line represents 1 pair |
refDatNames |
(NULL or character) allows placing selected pairs in context of larger data-set (names to match those of 'datPair') |
inclRepLst |
(logical) if TRUE, return list with 'clu' (clu-numbers, default output) and 'refLst' (list of clustered elements, only n>1) |
maxFuse |
(integer, default NULL) maximal number of groups/clusters |
debug |
(logical) display additional messages for debugging |
silent |
(logical) suppress messages |
callFrom |
(character) allow easier tracking of message(s) produced |
This function returns a vector with cluster-numbers
daPa <- matrix(c(1:5,8,2:6,9), ncol=2) fusePairs(daPa, maxFuse=4)daPa <- matrix(c(1:5,8,2:6,9), ncol=2) fusePairs(daPa, maxFuse=4)
get1stOfRepeatedByCol sorts matrix 'mat' and extracts only 1st occurance of values in column 'sortBy'.
Returns then non-redundant matrix (ie for column 'sortBy', if 'markIfAmbig' specifies existing col, mark ambig there).
Note : problem when sortSupl or sortBy not present (or not intended for use)
get1stOfRepeatedByCol( mat, sortBy = "seq", sortSupl = "ty", asFirstLast = c("full", "inter"), markIfAmbig = c("ambig", "seqNa"), asList = FALSE, abmiPref = "_", silent = FALSE, debug = FALSE, callFrom = NULL )get1stOfRepeatedByCol( mat, sortBy = "seq", sortSupl = "ty", asFirstLast = c("full", "inter"), markIfAmbig = c("ambig", "seqNa"), asList = FALSE, abmiPref = "_", silent = FALSE, debug = FALSE, callFrom = NULL )
mat |
(matrix or data.frame) numeric vector to be tested |
sortBy |
(character) column name for which elements should be made unique, numeric or character column; 'sortSupl' .. add'l colname to always select specific 1st) |
sortSupl |
(character) default="ty" |
asFirstLast |
(character,length=2) to force specific strings from coluln 'sortSupl' as first and last when selecting 1st of repeated terms, default=c("full","inter") |
markIfAmbig |
(character,length=2) 1st will be set to 'TRUE' if ambiguous/repeated, 2nd will get (heading) prefix, default=c("ambig","seqNa") |
asList |
(logical) to return list with non-redundant ('unique') and removed lines ('repeats') |
abmiPref |
(character) prefix to note ambiguous entries/terms, default="_" |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns depending on argumnet 'asList' either list with non-redundant ('unique') and removed lines ('repeats')
firstOfRepeated for (more basic) treatment of simple vector, nonAmbiguousNum for numeric use (much faster !!!)
aa <- cbind(no=as.character(1:20),seq=sample(LETTERS[1:15],20,repl=TRUE), ty=sample(c("full","Nter","inter"),20,repl=TRUE),ambig=rep(NA,20),seqNa=1:20) get1stOfRepeatedByCol(aa)aa <- cbind(no=as.character(1:20),seq=sample(LETTERS[1:15],20,repl=TRUE), ty=sample(c("full","Nter","inter"),20,repl=TRUE),ambig=rep(NA,20),seqNa=1:20) get1stOfRepeatedByCol(aa)
This function allows extacting, checking and combinig elements defining labels for pairwise comparisons.
getPairwiseSetup( pwGrpNa, grpNa = NULL, sep = NULL, combPwSep = "combine1", silent = FALSE, debug = FALSE, callFrom = NULL )getPairwiseSetup( pwGrpNa, grpNa = NULL, sep = NULL, combPwSep = "combine1", silent = FALSE, debug = FALSE, callFrom = NULL )
pwGrpNa |
(character) the names of pairwise-testing (ie 'concatenated' |
grpNa |
(character) the names of the groups of replicates (ie conditions) used to test |
sep |
(NULL or character, length=1) if not |
combPwSep |
(character) sequence of separators for building combined names; may be combPwSep='combine1' or 'combine2'; will be used in pwSeparatorList() |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function was designed to support functions exploiting pairwise testing results like plotting functions for Volcano-Plots etc.
Initially the function will check if the object given as argument pwGrpNa is an MAarrayLM-objects object and/or was created using moderTestXgrp.
If yes, the function will try to extract names of groups, pairwise combinations and separator used from $setup, if present.
If no $setup found this function will check through several elements in MAarrayLM-objects to gather all elements needed.
2) The separator sep is given and exact matches at both sides will be searched.
However, if the character(s) from sep do appear inside pwGrpNa no matches will be found.
If some pwGrpNa are not found in grpNa this will be marked as NA.
Finally, if no testing result is given as input, basic parameters group-names, pairwise names and the separator to be used can be combined into a list.
This function returns a list with $ind with matrix of indexes to (sorted) pwGrpNa for each pairwise comparison;
$pwGrpNames with matrix of pwGrpNa for each pairwise comparison;
$sep for the separator found ; $pwGrpNa which recapitulates (sorted) pwGrpNa as factor
(for running multiple pair-wise test) moderTestXgrp, convPairwiseSetup, presenceFilt, getPWseparator, indexGroupsFromPW,
(used underneith:) grep, strsplit
grp3 <- factor(rep(LETTERS[c(3,1,4)],c(2,3,3))) set.seed(2017); t8 <- matrix(round(rnorm(208*8,10,0.4),2), ncol=8, dimnames=list(paste(letters[],rep(1:8,each=26),sep=""), paste0(grp3, c(1:2,1:3,1:3)))) test1 <- moderTestXgrp(t8, grp3) getPairwiseSetup(test1)grp3 <- factor(rep(LETTERS[c(3,1,4)],c(2,3,3))) set.seed(2017); t8 <- matrix(round(rnorm(208*8,10,0.4),2), ncol=8, dimnames=list(paste(letters[],rep(1:8,each=26),sep=""), paste0(grp3, c(1:2,1:3,1:3)))) test1 <- moderTestXgrp(t8, grp3) getPairwiseSetup(test1)
Identify Separator In Pairwise Group-Names Or Find Separator For Use With Pairwise Group-Names
This function allows identifing separator used when pairwise groups are presented.
getPWseparator( compNames = NULL, grp = NULL, potSep = c("-", "---", "_", "___", ".", "-vs-", "_vs_", "--vs--", "__vs__", " ", " ", "--", "__"), includeGrp = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )getPWseparator( compNames = NULL, grp = NULL, potSep = c("-", "---", "_", "___", ".", "-vs-", "_vs_", "--vs--", "__vs__", " ", " ", "--", "__"), includeGrp = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )
compNames |
(character or integer) names of pairwise combined group-names |
grp |
(character or factor) optional groups (may include group-names that do not occur in |
potSep |
(character) potential separators to be checked if occuring in |
includeGrp |
(logical) if |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Note : Potential separators potSep must be at least 1 character long
The character '.' may used as separator (argument potSep), it will be protected internally for obtaining correct results when using grep().
Note : The indexing is relative to the levels of grp, thus to sorted group-names !
Cases of usage :
1) Identify separator used in concatenated labels, ie concatenated group-names are given, (only argument compNames is obligatory)
2) Suggets/Find suitable separator for given group-labels (ie a separator not occurring in any of the group-labels) when names
of grp given (thus argument grp is obligatory),
the first instance of potSep fitting will be chosen
This function returns a character vector (length=1) of the (first) separator fitting to all data, or a list with $sep and $grpNa if includeGrp=TRUE
indexGroupsFromPW, getPWseparator, colnames of testing results from moderTestXgrp, used by replacePWseparator
## Suggest separator getPWseparator(grp=LETTERS[1:3]) getPWseparator(grp=c("B-C","D","E")) getPWseparator(grp=c("B-C","D","E"), includeGrp=TRUE) ## Identify separator used getPWseparator(compNames=c("B-C","B-D","C-D")) getPWseparator(compNames=c("B-C","B-D","C-D"), includeGrp=TRUE)## Suggest separator getPWseparator(grp=LETTERS[1:3]) getPWseparator(grp=c("B-C","D","E")) getPWseparator(grp=c("B-C","D","E"), includeGrp=TRUE) ## Identify separator used getPWseparator(compNames=c("B-C","B-D","C-D")) getPWseparator(compNames=c("B-C","B-D","C-D"), includeGrp=TRUE)
When data have repeated elements (defined by names inside the vector), it may be advantageous to run some operations
only on a unique set of the initial data, or somtimes all repeated occurances need to be replaced by a common (summarizing) value.
This function allows to re-introduce new values from on second vector with unique names, to return a final vector of initial input-length and order of names (elements) like initial, too.
Normally the user would provide 'datUniq' (without repeated names) containing new values which will be expanded to structure of 'dat',
if 'datUniq' is not provided a vector with unique names will be made using the first occurance of repeated value(s).
For more complex cases the indexing relative to 'datUniq' can be returned (setting asIndex=TRUE).
Note: If not all names of 'dat' are found in 'datUniq' the missing spots will be returned as NA.
getValuesByUnique( dat, datUniq = NULL, asIndex = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )getValuesByUnique( dat, datUniq = NULL, asIndex = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )
dat |
(numeric or character) main long input, must have names |
datUniq |
(numeric or character) will be used to impose values on |
asIndex |
(logical) if |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
vector of length dat with imposed values, or index values if asIndex=TRUE
unique, findRepeated, correctToUnique, treatTxtDuplicates
dat <- 11:19 names(dat) <- letters[c(6:3,2:4,8,3)] ## let's make a 'datUniq' with the mean of repeated values : datUniq <- round(tapply(dat,names(dat),mean),1) ## now propagate the mean values to the full vector getValuesByUnique(dat,datUniq) cbind(ini=dat,firstOfRep=getValuesByUnique(dat,datUniq), indexUniq=getValuesByUnique(dat,datUniq,asIn=TRUE))dat <- 11:19 names(dat) <- letters[c(6:3,2:4,8,3)] ## let's make a 'datUniq' with the mean of repeated values : datUniq <- round(tapply(dat,names(dat),mean),1) ## now propagate the mean values to the full vector getValuesByUnique(dat,datUniq) cbind(ini=dat,firstOfRep=getValuesByUnique(dat,datUniq), indexUniq=getValuesByUnique(dat,datUniq,asIn=TRUE))
This functions converts a given urlName so that (tabular) data from GitHub (https://github.com/) can data be read correctly as tabular data.
gitDataUrl( urlName, replTxt = NULL, silent = FALSE, debug = FALSE, callFrom = NULL )gitDataUrl( urlName, replTxt = NULL, silent = FALSE, debug = FALSE, callFrom = NULL )
urlName |
(charachter) main url-address |
replTxt |
(NULL or matrix) adjust/ custom-modify search- and replacement items; default settings will exchange the beginning of the site to 'raw.githubusercontent.com' and then exchange 'blob' to 'refs/head' otherwise should be matrix with 2 columns, the 1st colimn entries will be used as 'search-for' and the 2nd as 'replace by' for each row |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Thus, this will exchange the beginning of the site to 'raw.githubusercontent.com' and then exchange 'blob' to 'refs/head' . Alternatively, the user may custom define all terms to get exchanged (as matrix with 2 columns 'old' and 'new').
Note : The default spearator from read.delim may suit better for reading the data.
corrected urlName
url1 <- paste0("https://github.com/bigbio/proteomics-metadata-standard/blob/", "main/datasets/PXD001819/PXD001819.sdrf.tsv") rbind(ini=url1, new=gitDataUrl(url1))url1 <- paste0("https://github.com/bigbio/proteomics-metadata-standard/blob/", "main/datasets/PXD001819/PXD001819.sdrf.tsv") rbind(ini=url1, new=gitDataUrl(url1))
Converts 'txt' so that (the most common) special characters (like 'beta','micro','square' etc) will be displayed correctly whe used for display in html (eg at mouse-over).
Note : The package stringi is required for the conversions (the input will get returned if stringi is not available).
Currently only the 16 most common special characters are implemented.
htmlSpecCharConv(txt, silent = FALSE, callFrom = NULL, debug = FALSE)htmlSpecCharConv(txt, silent = FALSE, callFrom = NULL, debug = FALSE)
txt |
character vector, including special characters |
silent |
(logical) suppress messages |
callFrom |
(character) allow easier tracking of messages produced |
debug |
(logical) additional messages for debugging |
This function returns a corrected character vector adopted for html display
tables on https://www.htmlhelp.com/reference/html40/entities/latin1.html,
https://www.degraeve.com/reference/specialcharacters.php, or https://ascii.cl/htmlcodes.htm
## we'll use the package stringi to generate text including the 'micro'-symbol as input x <- if(requireNamespace("stringi", quietly=TRUE)) { stringi::stri_unescape_unicode("\\u00b5\\u003d\\u0061\\u0062")} else "\"x=axb\"" htmlSpecCharConv(x)## we'll use the package stringi to generate text including the 'micro'-symbol as input x <- if(requireNamespace("stringi", quietly=TRUE)) { stringi::stri_unescape_unicode("\\u00b5\\u003d\\u0061\\u0062")} else "\"x=axb\"" htmlSpecCharConv(x)
This function allows matching which groups are cited in a pairwise concatenated manner.
This function can also be used to split concatenated group-names (while automatically determining a suitable separator) and display as matrix when includeGrp=TRUE.
Replaces matchSampToPairw() ???
indexGroupsFromPW( compNames, grp = NULL, potSep = pwSeparatorList("combine1"), includeGrp = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )indexGroupsFromPW( compNames, grp = NULL, potSep = pwSeparatorList("combine1"), includeGrp = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )
compNames |
(vector of character or integer, or matrix) names of pairwise combined group-names; if matrix the rownames of |
grp |
(character or factor) optional groups (may include group-names that do not occur in |
potSep |
(character) potential separators to be checked if occuring in |
includeGrp |
(logical) instead of matrix, rather return list with $pwInd, $pwGrpNames (group-names corresponding to index), $sep (separator used to split) and $grpNa |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns a numeric matrix with indexes corresponding to (sorted) group-names as they appear in compNames;
or if includeGrp=TRUE a list with $ind (matrix indexes for each compNames), $grpNames (group-names corresponding to index), $sep (separator used to split) and $grpNa (sorted names of types of groups)
moderTestXgrp (colnames of testing results from this function may be used); replacePWseparator; used internally getPWseparator, pwSeparatorList, .getPWseparator
indexGroupsFromPW(c("C-B","B-D","C-D")) indexGroupsFromPW(c("C-B","B-D","C-D"), grp=rep(LETTERS[1:6],2), includeGrp=TRUE)indexGroupsFromPW(c("C-B","B-D","C-D")) indexGroupsFromPW(c("C-B","B-D","C-D"), grp=rep(LETTERS[1:6],2), includeGrp=TRUE)
This function allows recovering the single longest common text-fragments (from center, head or tail) out of character vector txt.
Only the first of all of the longest solutions will be returned.
keepCommonText( txt, minNchar = 1, side = "center", hiResol = TRUE, silent = TRUE, callFrom = NULL, debug = FALSE )keepCommonText( txt, minNchar = 1, side = "center", hiResol = TRUE, silent = TRUE, callFrom = NULL, debug = FALSE )
txt |
character vector to be treated |
minNchar |
(integer) minumin number of characters that must remain |
side |
(character) may be be either 'center', 'any', 'terminal', 'left' or 'right'; only with |
hiResol |
(logical) find best solution, but at much higher comptational cost (eg 3x slower, however |
silent |
(logical) suppress messages |
callFrom |
(character) allow easier tracking of messages produced |
debug |
(logical) display additional messages for debugging |
Please note, that finding common parts between chains of characters is not a completely trivial task. This topic still has ongoing research for the application of sequence-alignments, where chains of characters to be compared get very long. This function uses a k-mer inspirated approach. The initial aim with this function was allowing to treat smaller chains of characters (and finding shorter strteches of common text), like eg with column-names.
Important : This function identifies only the first best hit, ie other shared/common character-chains of the same length will not be found !
Using the argument hiResol=FALSE it is possible to accelerate the search aprox 3x (with larger character-vectors), however, frequently the very best solution may not be found.
This means, that in this case the result should rather be considered a 'seed', allowing check if further extension may improve the result,
ie for identifying a (slightly) longer chain of common characters.
With longer vectors and longer character chains this may get demanding on computational reesources, the argument hiResol=FALSE allows reducing this at the price of missing the best solution.
With this argument single common/matching characters will not be searched if all text-elements are longer than 500 characters, an empty character vector will be returned.
When argument side is either left, right or terminal only terminal common text may be found (a potentially even longer internal text will be lost).
Of course, choosing this option makes searches much faster.
This function does not return the position of the shared/common characters within the text, you may use gregexpr or regexec to locate them.
This function returns a character vector of length=1, ie only one (normally the longest) common sequence of characters is identified. If nothing is found common/shared an empty character-vector is returned
Use gregexpr or regexec in grep for locating the identified common characters in the initial query.
Inverse : Trim redundant text (from either side) to keep only varaible part using trimRedundText;
you may also look for related functions in package stringr
txt1 <- c("abcd_abc_kjh", "bcd_abc123", "cd_abc_po") keepCommonText(txt1, side="center") # trim from right txt2 <- c("ddd_ab","ddd_bcd","ddd_cde") trimRedundText(txt2, side="left") # keepCommonText(txt2, side="center") #txt1 <- c("abcd_abc_kjh", "bcd_abc123", "cd_abc_po") keepCommonText(txt1, side="center") # trim from right txt2 <- c("ddd_ab","ddd_bcd","ddd_cde") trimRedundText(txt2, side="left") # keepCommonText(txt2, side="center") #
This function helps transforming a numeric or character vector into indexes of levels (of its original values).
By default indexes are assigned by order of occurance, ie, the first value of x will be get the index of 1.
Using the argument byOccurance=FALSE the resultant indexes will follow the sorted values.
levIndex( dat, byOccurance = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )levIndex( dat, byOccurance = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )
dat |
(numeric or character vector or factor) main input |
byOccurance |
(logical) toogle if lowest index should be based on alphabetical order or on order of input |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
matrix with mean values
x1 <- letters[rep(c(5,2:3),1:3)] levIndex(x1) levIndex(x1, byOccurance=FALSE) ## with factor fa1 <- factor(letters[rep(c(5,2:3),1:3)], levels=letters[1:6]) levIndex(fa1) levIndex(fa1, byOccurance=FALSE)x1 <- letters[rep(c(5,2:3),1:3)] levIndex(x1) levIndex(x1, byOccurance=FALSE) ## with factor fa1 <- factor(letters[rep(c(5,2:3),1:3)], levels=letters[1:6]) levIndex(fa1) levIndex(fa1, byOccurance=FALSE)
The aim of this function is to select the data suiting set of levels on the main input data to construct a linear regression model.
linModelSelect( rowNa, dat, expect, logExpect = FALSE, startLev = NULL, lisNa = c(raw = "raw", annot = "annot", datImp = "datImp"), plotGraph = TRUE, tit = NULL, pch = c(1, 3), cexLeg = 0.95, cexSub = 0.85, xLab = NULL, yLab = NULL, cexXAxis = 0.85, cexYAxis = 0.9, xLabLas = 1, cexLab = 1.1, suppressWarnings = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )linModelSelect( rowNa, dat, expect, logExpect = FALSE, startLev = NULL, lisNa = c(raw = "raw", annot = "annot", datImp = "datImp"), plotGraph = TRUE, tit = NULL, pch = c(1, 3), cexLeg = 0.95, cexSub = 0.85, xLab = NULL, yLab = NULL, cexXAxis = 0.85, cexYAxis = 0.9, xLabLas = 1, cexLab = 1.1, suppressWarnings = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )
rowNa |
(character or numeric, length=1) if |
dat |
(matrix, list or MArrayLM-object from limma) main input of which columns should get re-ordered, may be output from |
expect |
(numeric of character) the expected levels; if character, constant unit-characters will be stripped away to extact the numeric content |
logExpect |
(logical) toggle to |
startLev |
(integer) specify all starting levels to test for omitting here (multiple start sites for modelling linear regression may be specified to finally pick the best model) |
lisNa |
(character) in case |
plotGraph |
(logical) display figure |
tit |
(character) optional custom title |
pch |
(integer) symbols to use n optional plot; 1st for regular values, 2nd for values not used in regression |
cexLeg |
(numeric) size of text in legend |
cexSub |
(numeric) text-size for line (as subtitle) giving regression details of best linear model) |
xLab |
(character) custom x-axis label |
yLab |
(character) custom y-axis label |
cexXAxis |
(character) |
cexYAxis |
(character) |
xLabLas |
(integer) |
cexLab |
(numeric) |
suppressWarnings |
(logical) suppress warnings from lm() that may appear when NAs get introduced |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
In real world measurements one may be confronted to the case of very low level analytes below the detection limit (LOD) and resulting read-outs fluctuate around around a common baseline (instead of NA).
With such data it may be preferable to omit the read-outs for the lowest concentrations/levels of analytes if they are spread around a base-line value.
This function allows trying to omit all starting levels designed in startLev, then the resulting p-values for the linear regression slopes will be checked and the best p-value chosen.
The input may also be a MArrayLM-type object from package limma or from moderTestXgrp or moderTest2grp.
In the graphical representation all points assocoated to levels omitted are shown in light green.
For the graphical display additional information can be used : If the dat is list or MArrayLM-type object,
the list-elements $raw (according to argument lisNa will be used to display points initially given as NA ad imputed lateron in grey.
Logarithmic (ie log-linear) data can be treated by settting argument logExpect=TRUE. Then the levels will be taken as exponent of 2 for the regression, while the original values will be displayed in the figure.
This function returns a list with $coef (coefficients), $name (as/from input rowNa), $startLev the best starting level)
moderTestXgrp for single comparisons, order
## Construct data li1 <- rep(c(4,3,3:6),each=3) + round(runif(18)/5,2) names(li1) <- paste0(rep(letters[1:5], each=3), rep(1:3,6)) li2 <- rep(c(6,3:7), each=3) + round(runif(18)/5, 2) dat2 <- rbind(P1=li1, P2=li2) exp2 <- rep(c(11:16), each=3) ## Check & plot for linear model linModelSelect("P2", dat2, expect=exp2) ## Log-Linear data ## Suppose dat2 is result of measures in log2, but exp4 is not exp4 <- rep(c(3,10,30,100,300,1000), each=3) linModelSelect("P2", dat2, expect=exp4, logE=FALSE) # bad linModelSelect("P2", dat2, expect=exp4, logE=TRUE)## Construct data li1 <- rep(c(4,3,3:6),each=3) + round(runif(18)/5,2) names(li1) <- paste0(rep(letters[1:5], each=3), rep(1:3,6)) li2 <- rep(c(6,3:7), each=3) + round(runif(18)/5, 2) dat2 <- rbind(P1=li1, P2=li2) exp2 <- rep(c(11:16), each=3) ## Check & plot for linear model linModelSelect("P2", dat2, expect=exp2) ## Log-Linear data ## Suppose dat2 is result of measures in log2, but exp4 is not exp4 <- rep(c(3,10,30,100,300,1000), each=3) linModelSelect("P2", dat2, expect=exp4, logE=FALSE) # bad linModelSelect("P2", dat2, expect=exp4, logE=TRUE)
This function fits a linear regression and returns the parameters, including p-values from Anova.
Here the vector 'y' (scalar response or dependent variable, ie the value that should get estimated) will be estimated according to 'dep' (explanatory or independent variable).
Alternatively, 'dep' may me a matrix where 1st column will be used as 'dep and the 2nd column as 'y'.
linRegrParamAndPVal( dep, y = NULL, asVect = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )linRegrParamAndPVal( dep, y = NULL, asVect = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )
dep |
(numeric vector, matrix or data.frame) explanatory or dependent variable, if matrix or data.frame the 1st column will be used, if 'y'= |
y |
(numeric vector) independent variable (the value that should get estimated based on 'dep') |
asVect |
(logical) return numeric vector (Intercept, slope, p.intercept, p.slope) or matrix or results |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
numeric vector (Intercept, slope, p.intercept, p.slope), or if asVect==TRUE as matrix (p.values in 2nd column)
linRegrParamAndPVal(c(5,5.1,8,8.2),gl(2,2))linRegrParamAndPVal(c(5,5.1,8,8.2),gl(2,2))
listBatchReplace replaces in list lst all entries with value searchValue by replaceBy
listBatchReplace( lst, searchValue, replaceBy, silent = FALSE, debug = FALSE, callFrom = NULL )listBatchReplace( lst, searchValue, replaceBy, silent = FALSE, debug = FALSE, callFrom = NULL )
lst |
input-list to be used for replacing |
searchValue |
(character, length=1) |
replaceBy |
(character, length=1) |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns a corrected list
basic replacement sub in grep
lst1 <- list(aa=1:4, bb=c("abc","efg","abhh","effge"), cc=c("abdc","efg")) listBatchReplace(lst1, search="efg", repl="EFG", sil=FALSE)lst1 <- list(aa=1:4, bb=c("abc","efg","abhh","effge"), cc=c("abdc","efg")) listBatchReplace(lst1, search="efg", repl="EFG", sil=FALSE)
Sort values of 'x' by its names and organize as list by common names, the names until 'sep' are used for (re)grouping.
Note that typical spearators occuring the initial names may need protection by '\' (this is automatically taken care of for the case of the dot ('.') separator).
listGroupsByNames(x, sep = ".", silent = FALSE, debug = FALSE, callFrom = NULL)listGroupsByNames(x, sep = ".", silent = FALSE, debug = FALSE, callFrom = NULL)
x |
(list) main input |
sep |
(character) separator (note that typcal separators may need to be protected, only automatically added for '.') |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns a matrix or data.frame
rbind in cbind
listGroupsByNames((1:10)/5) ser1 <- 1:6; names(ser1) <- c("AA","BB","AA.1","CC","AA.b","BB.e") listGroupsByNames(ser1)listGroupsByNames((1:10)/5) ser1 <- 1:6; names(ser1) <- c("AA","BB","AA.1","CC","AA.b","BB.e") listGroupsByNames(ser1)
lmSelClu runs linear regression on data segmented previously (eg by clustering).
This functio offers various types of (2-coefficient) linear regression on 2 columns of 'dat' (matrix with 3rd col named 'clu' or 'cluID', numeric elements for cluster-number).
If argument 'clu' is (default) 'max', the column 'clu' will be inspected to take most frequent value of 'clu', otherwise a numeric entry specifying the cluster to extract is expected.
Note: this function was initially made for use with results from diagCheck()
Note: this function lacks means of judging godness of fit of the regression preformed & means for plotting
lmSelClu( dat, useCol = 1:2, clu = "max", regTy = "lin", filt1 = NULL, filt2 = NULL, silent = FALSE, debug = FALSE, callFrom = NULL )lmSelClu( dat, useCol = 1:2, clu = "max", regTy = "lin", filt1 = NULL, filt2 = NULL, silent = FALSE, debug = FALSE, callFrom = NULL )
dat |
matrix or data.frame |
useCol |
(integer or charcter) specify which 2 columns of 'dat' to use for linear regression |
clu |
(character) name of cluster to be extracted and treatad |
regTy |
(character) change type used for linear regression : 'lin' for 1st col ~ 2nd col, 'res' for residue ~ 2nd col, 'norRes' for residue/2nd col ~2nd col or 'sqNorRes','inv' for 1st col ~ 1/(2nd col), 'invRes' for residue ~ 1/(2nd col) |
filt1 |
(logical or numerical) filter criteria for 1st of 'useCol' , if numeric then select all lines of dat less than max of filt1 |
filt2 |
(logical or numerical) filter criteria for 2nd of 'useCol' , if numeric then select all lines of dat less than max of filt2 |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
lm object (or NULL if no data left)
set.seed(2016); ran1 <- runif(220) mat1 <- round(rbind(matrix(c(1:100+ran1[1:100],rep(1,50)),ncol=3), matrix(c(1:60,68:9+ran1[101:160],rep(2,60)),nc=3)),1) colnames(mat1) <- c("a","BB","clu") lmSelClu(mat1) plot(mat1[which(mat1[,3]=="2"),1:2],col=grey(0.6)) abline(lmSelClu(mat1),lty=2,lwd=2) # mat2 <- round(rbind(matrix(c(1:100+ran1[1:100],rep(1,50)),ncol=3), matrix(c(1:60,(2:61+ran1[101:160])^2,rep(2,60)),nc=3)),1) colnames(mat2) <- c("a","BB","clu") (reg2 <- lmSelClu(mat2,regTy="sqNor")) plot(function(x) coef(reg2)[2]+ (coef(reg2)[2]*x^2),xlim=c(1,70)) points(mat2[which(mat2[,3]=="2"),1:2],col=2)set.seed(2016); ran1 <- runif(220) mat1 <- round(rbind(matrix(c(1:100+ran1[1:100],rep(1,50)),ncol=3), matrix(c(1:60,68:9+ran1[101:160],rep(2,60)),nc=3)),1) colnames(mat1) <- c("a","BB","clu") lmSelClu(mat1) plot(mat1[which(mat1[,3]=="2"),1:2],col=grey(0.6)) abline(lmSelClu(mat1),lty=2,lwd=2) # mat2 <- round(rbind(matrix(c(1:100+ran1[1:100],rep(1,50)),ncol=3), matrix(c(1:60,(2:61+ran1[101:160])^2,rep(2,60)),nc=3)),1) colnames(mat2) <- c("a","BB","clu") (reg2 <- lmSelClu(mat2,regTy="sqNor")) plot(function(x) coef(reg2)[2]+ (coef(reg2)[2]*x^2),xlim=c(1,70)) points(mat2[which(mat2[,3]=="2"),1:2],col=2)
rbind-like function to append list-elements containing matrixes (or data.frames) and return one long table. All list-elements must have same number of columns (and same types of classes in case of data.frames. Simple vectors (as list-elements) will be considered as sigle lines for attaching.
lrbind(lst, silent = FALSE, debug = FALSE, callFrom = NULL)lrbind(lst, silent = FALSE, debug = FALSE, callFrom = NULL)
lst |
(list, composed of multiple matrix or data.frames or simple vectors) main input (each list-element should have same number of columns, numeric vectors will be converted to number of columns of other columns/elements) |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns (depending on input) a matrix or data.frame
rbind in cbind
lst1 <- list(matrix(1:9, ncol=3, dimnames=list(letters[1:3],c("AA","BB","CC"))), 11:13, matrix(51:56, ncol=3)) lrbind(lst1)lst1 <- list(matrix(1:9, ncol=3, dimnames=list(letters[1:3],c("AA","BB","CC"))), 11:13, matrix(51:56, ncol=3)) lrbind(lst1)
makeMAList extracts sets of data-pairs (like R & G series) and makes MA objects as MA-List object (eg for ratio oriented analysis).
The grouping of columns as sets of replicate-measurements is done according to argumnet MAfac.
The output is fully compatible to functions of package limma (Bioconductor).
makeMAList( mat, MAfac, useF = c("R", "G"), isLog = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )makeMAList( mat, MAfac, useF = c("R", "G"), isLog = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )
mat |
main input matrix |
MAfac |
(factor) factor orgnaizing columns of 'mat' (if |
useF |
(character) two specific factor-leves of |
isLog |
(logical) tell if data is already log2 (will be considered when computing M and A values) |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function requires Bioconductor package limma being installed.
limma-type "MAList" containing M and A values
test2factLimma, for creating RG-lists within limma: MA.RG in normalizeWithinArrays
set.seed(2017); t4 <- matrix(round(runif(40,1,9),2), ncol=4, dimnames=list(letters[c(1:5,3:4,6:4)], c("AA1","BB1","AA2","BB2"))) makeMAList(t4, gl(2,2,labels=c("R","G")))set.seed(2017); t4 <- matrix(round(runif(40,1,9),2), ncol=4, dimnames=list(letters[c(1:5,3:4,6:4)], c("AA1","BB1","AA2","BB2"))) makeMAList(t4, gl(2,2,labels=c("R","G")))
This function takes matrix or data.frame 'dat' to summarize redundant lines (column argument iniID) along method specified in summarizeRedAs
to treat all lines with redundant iniID by same approach (ie for all columns the line where specified column is at eg max = 'maxOfRef' ).
If no name given, the function will take the last numeric (factors may be used - they will be read as levels).
makeNRedMatr( dat, summarizeRedAs, iniID = "iniID", retDataFrame = TRUE, nEqu = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )makeNRedMatr( dat, summarizeRedAs, iniID = "iniID", retDataFrame = TRUE, nEqu = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )
dat |
(matrix or data.frame) main input for making non-redundant |
summarizeRedAs |
(character) summarization method(s), typical choices 'median','mean','min' or 'maxOfRef';
basic usage like |
iniID |
(character) column-name used as reference for determining groups of redundant lines (default="iniID") |
retDataFrame |
(logical) if |
nEqu |
(logical) if |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
When using for selection of single initial line give the character-string of argument summarizeRedAs a name (eg summ=c(X1="minOfRef")
so that the function will use ONLY the column specified via the name for determining which line should be used/kept.
It is possible to base the choice from 'redundant' lines on a single reference-column.
For example, when summarizeRedAs='maxOfRef' summarizing of all (numeric) columns will be performed according to one single column (ie the line where the last numeric column is at its max).
Otherwiser, a name can be assigned as reference column to be used (eg see last example using summarizeRedAs=c(x1='maxOfRef'))
This function returns a (numeric) matrix or data.frame with summarized data and add'l col with number of initial redundant lines
simple/partial functionality in summarizeCols, checkSimValueInSer
t3 <- data.frame(ref=rep(11:15,3),tx=letters[1:15], matrix(round(runif(30,-3,2),1),nc=2),stringsAsFactors=FALSE) by(t3,t3[,1],function(x) x) t(sapply(by(t3,t3[,1],function(x) x), summarizeCols, me="maxAbsOfRef")) # calculate mean for lines concerened of all columns : (xt3 <- makeNRedMatr(t3, summ="mean", iniID="ref")) # choose lines based only on content of column 'X1' (here: max): (xt3 <- makeNRedMatr(t3, summ=c(X1="maxOfRef"), iniID="ref"))t3 <- data.frame(ref=rep(11:15,3),tx=letters[1:15], matrix(round(runif(30,-3,2),1),nc=2),stringsAsFactors=FALSE) by(t3,t3[,1],function(x) x) t(sapply(by(t3,t3[,1],function(x) x), summarizeCols, me="maxAbsOfRef")) # calculate mean for lines concerened of all columns : (xt3 <- makeNRedMatr(t3, summ="mean", iniID="ref")) # choose lines based only on content of column 'X1' (here: max): (xt3 <- makeNRedMatr(t3, summ=c(X1="maxOfRef"), iniID="ref"))
This function allows adjusting the order of lines of a matrix mat to a reference character-vector ref,
even when initial direct matching of character-strings using match is not possible/successful.
In this case, various variants of using grep will be used to see if unambiguous matching is possible of characteristic parts of the text.
All columns of mat will be tested an the column giving the bes resuts will be used.
matchMatrixLinesToRef( mat, ref, exclCol = NULL, addRef = TRUE, inclInfo = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )matchMatrixLinesToRef( mat, ref, exclCol = NULL, addRef = TRUE, inclInfo = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )
mat |
(matrix or data.frame) main input, all columns of |
ref |
(character, length must match ) reference for trying to match each of the columns of |
exclCol |
(character or integer) column-name or -index of column to ignore/exclude when looking for matches |
addRef |
(logical), if |
inclInfo |
(logical) allows returning list with new matrix and additional information |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
This function tests all columns of mat to find perfect matching results to the reference ref.
In case of multiple results the
In case no direct matching is possible, grep will be used to find the best partial matching.
The orderof the rows of input mat will be adjusted according to the matching results.
If addRef=TRUE, the reference will be included as additional column to the results, too.
This function returns the input matrix in an adjusted order (plus an optional additional column showing the reference)
or if inclInfo=TRUE a list with $mat (adjusted matrix), $byColumn, $newOrder and $method;
the reference can bee added as additional last column if addRef=TRUE
match, grep, trimRedundText, replicateStructure
## Note : columns b and e allow non-ambigous match, not all elements of e are present in a mat0 <- cbind(a=c("mvvk","axxd","bxxd","vv"),b=c("iwwy","iyyu","kvvh","gxx"), c=rep(9,4), d=c("hgf","hgf","vxc","nvnn"), e=c("_vv_","_ww_","_xx_","_yy_")) matchMatrixLinesToRef(mat0[,1:4], ref=mat0[,5]) matchMatrixLinesToRef(mat0[,1:4], ref=mat0[1:3,5], inclInfo=TRUE) matchMatrixLinesToRef(mat0[,-2], ref=mat0[,2], inclInfo=TRUE) # needs 'reverse grep'## Note : columns b and e allow non-ambigous match, not all elements of e are present in a mat0 <- cbind(a=c("mvvk","axxd","bxxd","vv"),b=c("iwwy","iyyu","kvvh","gxx"), c=rep(9,4), d=c("hgf","hgf","vxc","nvnn"), e=c("_vv_","_ww_","_xx_","_yy_")) matchMatrixLinesToRef(mat0[,1:4], ref=mat0[,5]) matchMatrixLinesToRef(mat0[,1:4], ref=mat0[1:3,5], inclInfo=TRUE) matchMatrixLinesToRef(mat0[,-2], ref=mat0[,2], inclInfo=TRUE) # needs 'reverse grep'
This function provides a variant to match, where initially non-matching elements of x
will be tested by decomposing non-matching elements, reversing the parts in front and after the separator sep and re-matching.
If separator sep does not occur, a warning will be issued, if it occurs more than once,
the parts before and after the first separartor will be used and a warning issued.
matchNamesWithReverseParts( x, y, sep = "-", silent = FALSE, debug = FALSE, callFrom = NULL )matchNamesWithReverseParts( x, y, sep = "-", silent = FALSE, debug = FALSE, callFrom = NULL )
x |
(character) first vector for match |
y |
(character) second vector for match |
sep |
(character) separator between elements |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
index for matching (integer) x to y
tx1 <- c("a-b","a-c","d-a","d-b","b-c","d-c") tmp <- triCoord(4) tx2 <- paste(letters[tmp[,1]],letters[tmp[,2]],sep="-") ## Some matches won't be found, since 'a-d' got reversed to 'd-a', etc... match(tx1,tx1) matchNamesWithReverseParts(tx1,tx2)tx1 <- c("a-b","a-c","d-a","d-b","b-c","d-c") tmp <- triCoord(4) tx2 <- paste(letters[tmp[,1]],letters[tmp[,2]],sep="-") ## Some matches won't be found, since 'a-d' got reversed to 'd-a', etc... match(tx1,tx1) matchNamesWithReverseParts(tx1,tx2)
The column-names of multiple pairwise testing contain the names of the initial groups/conditions tested, plus there is a separator (eg '-' in moderTestXgrp).
Thus function allows to map back which groups/conditions were used by returning the index of the respective groups used in pair-wise sets.
matchSampToPairw( grpNa, pairwNa, sep = NULL, silent = FALSE, debug = FALSE, callFrom = NULL )matchSampToPairw( grpNa, pairwNa, sep = NULL, silent = FALSE, debug = FALSE, callFrom = NULL )
grpNa |
(character) the names of the groups of replicates (ie conditions) used to test |
pairwNa |
(character) the names of pairwise-testing (ie 'concatenated' |
sep |
(character) if not |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
There are two modes of operation : 1) Argument sep is set to NULL : The names of initial groups/conditions (grpNa)
will be tested for exact pattern matching either at beginning or at end of pair-wise names (pairwNa).
This approach has the advantage that it does not need to be known what character(s) were used as separator (or they may change),
but the disadvantage that in case the perfect grpNa was not given, the longest best match of grpNa will be returned.
2) The separator sep is given and exact matches at both sides will be searched.
However, if the character(s) from sep do appear inside grpNa no matches will be found.
If some grpNa are not found in pairwNa this will be marked as NA.
This function checks also if a double version of sep may fit better to grpNa
and will adjust sep accordingly (eg adjust sep='-' to '–').
This function returns a matrix of 2 columns with inidices of sampNa with pairwNa as rows
(for running multiple pair-wise test) moderTestXgrp, grep, strsplit
pairwNa1 <- c("abc-efg","abc-hij","efg-hij") grpNa1 <- c("hij","abc","abcc","efg","klm") matchSampToPairw(grpNa1, pairwNa1) pairwNa2 <- c("abc-efg","abcc-hij","abc-hij","abc-hijj","zz-zz","efg-hij") matchSampToPairw(grpNa1, pairwNa2)pairwNa1 <- c("abc-efg","abc-hij","efg-hij") grpNa1 <- c("hij","abc","abcc","efg","klm") matchSampToPairw(grpNa1, pairwNa1) pairwNa2 <- c("abc-efg","abcc-hij","abc-hij","abc-hijj","zz-zz","efg-hij") matchSampToPairw(grpNa1, pairwNa2)
convert matrix to list of vectors: each column of 'mat' as vector of list
matr2list(mat, concSym = ".", silent = FALSE, debug = TRUE, callFrom = NULL)matr2list(mat, concSym = ".", silent = FALSE, debug = TRUE, callFrom = NULL)
mat |
(matrix) main input |
concSym |
(character) symbol for concatenating: concatenation of named vectors in list names as colname(s)+'concSym'+rowname |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
matrix or array (1st dim is intraplate-position, 2nd .. plate-group/type, 3rd .. channels)
mat1 <- matrix(1:12,ncol=3,dimnames=list(letters[1:4],LETTERS[1:3])) mat2 <- matrix(LETTERS[11:22],ncol=3,dimnames=list(letters[1:4],LETTERS[1:3])) matr2list(mat1); matr2list(mat2)mat1 <- matrix(1:12,ncol=3,dimnames=list(letters[1:4],LETTERS[1:3])) mat2 <- matrix(LETTERS[11:22],ncol=3,dimnames=list(letters[1:4],LETTERS[1:3])) matr2list(mat1); matr2list(mat2)
This function allows merging of multiple matrix-like objects.
The matix-rownames will be used to align common elements, either be returning all common elements mode='intersect' or containg all elements mode='union' (the result may contains additional NAs).
mergeMatrices( ..., mode = "intersect", useColumn = 1, na.rm = TRUE, extrRowNames = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )mergeMatrices( ..., mode = "intersect", useColumn = 1, na.rm = TRUE, extrRowNames = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )
... |
(matrix or data.frame) multiple matrix or data.frame objects may be entered |
mode |
(character) allows choosing restricting to all common elements ( |
useColumn |
(integer, character or list) the column(s) to consider, may be |
na.rm |
(logical) suppress |
extrRowNames |
(logical) decide whether columns with all values different (ie no replicates or max divergency) should be excluded |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Custom column-names can be given by entering matrices like named arguments (see examples below).
The choice of columns tu use may be adopted to each matrix entered, in this case the argument useColumn may be a list with matrix-names to use or a list of indexes (see examples below).
Note, that matrices may contain repeated rownames (see examples, mat3). In this case only the first of repeated rownames will be considered (and lines of repeated names ignored).
This function returns a matrix containing all selected columns of the input matrices to fuse
mat1 <- matrix(11:18, ncol=2, dimnames=list(letters[3:6],LETTERS[1:2])) mat2 <- matrix(21:28, ncol=2, dimnames=list(letters[2:5],LETTERS[3:4])) mat3 <- matrix(31:38, ncol=2, dimnames=list(letters[c(1,3:4,3)],LETTERS[4:5])) mergeMatrices(mat1, mat2) mergeMatrices(mat1, mat2, mat3, mode="union", useCol=2) ## custom names for matrix-origin mergeMatrices(m1=mat1, m2=mat2, mat3, mode="union", useCol=2) ## flexible/custom selection of columns mergeMatrices(m1=mat1, m2=mat2, mat3, mode="union", useCol=list(1,1:2,2))mat1 <- matrix(11:18, ncol=2, dimnames=list(letters[3:6],LETTERS[1:2])) mat2 <- matrix(21:28, ncol=2, dimnames=list(letters[2:5],LETTERS[3:4])) mat3 <- matrix(31:38, ncol=2, dimnames=list(letters[c(1,3:4,3)],LETTERS[4:5])) mergeMatrices(mat1, mat2) mergeMatrices(mat1, mat2, mat3, mode="union", useCol=2) ## custom names for matrix-origin mergeMatrices(m1=mat1, m2=mat2, mat3, mode="union", useCol=2) ## flexible/custom selection of columns mergeMatrices(m1=mat1, m2=mat2, mat3, mode="union", useCol=list(1,1:2,2))
This function allows merging of multiple matrix-like objects from an initial list.
The matix-rownames will be used to align common elements, either be returning all common elements mode='intersect' or containg all elements mode='union' (the result may contains additional NAs).
mergeMatrixList( matLst, mode = "intersect", useColumn = 1, na.rm = TRUE, extrRowNames = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )mergeMatrixList( matLst, mode = "intersect", useColumn = 1, na.rm = TRUE, extrRowNames = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )
matLst |
(list containing matrices or data.frames) main input (multiple matrix or data.frame objects) |
mode |
(character) allows choosing restricting to all common elements ( |
useColumn |
(integer, character or list) the column(s) to consider, may be |
na.rm |
(logical) suppress |
extrRowNames |
(logical) decide whether columns with all values different (ie no replicates or max divergency) should be excluded |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Custom column-names can be given by entering matrices like named arguments (see examples below).
The choice of columns tu use may be adopted to each matrix entered, in this case the argument useColumn may be a list with matrix-names to use or a list of indexes (see examples below).
Note, that matrices may contain repeated rownames (see examples, mat3). In this case only the first of repeated rownames will be considered (and lines of repeated names ignored).
This function returns a matrix containing all selected columns of the input matrices to fuse
merge, mergeMatrices for separate entries
mat1 <- matrix(11:18, ncol=2, dimnames=list(letters[3:6],LETTERS[1:2])) mat2 <- matrix(21:28, ncol=2, dimnames=list(letters[2:5],LETTERS[3:4])) mat3 <- matrix(31:38, ncol=2, dimnames=list(letters[c(1,3:4,3)],LETTERS[4:5])) mergeMatrixList(list(mat1, mat2)) mergeMatrixList(list(m1=mat1, m2=mat2, mat3), mode="union", useCol=2)mat1 <- matrix(11:18, ncol=2, dimnames=list(letters[3:6],LETTERS[1:2])) mat2 <- matrix(21:28, ncol=2, dimnames=list(letters[2:5],LETTERS[3:4])) mat3 <- matrix(31:38, ncol=2, dimnames=list(letters[c(1,3:4,3)],LETTERS[4:5])) mergeMatrixList(list(mat1, mat2)) mergeMatrixList(list(m1=mat1, m2=mat2, mat3), mode="union", useCol=2)
This function merges selected columns out of 2 matrix or data.frames. 'selCols' will be used to define columns to be used; optionally may be different for 'dat2' : define in 'supCols2'. Output-cols will get additions specified in newSuff (default '.x' and '.y')
mergeSelCol( dat1, dat2, selCols, supCols2 = NULL, byC = NULL, useAll = FALSE, setRownames = TRUE, newSuff = c(".x", ".y"), silent = FALSE, debug = FALSE, callFrom = NULL )mergeSelCol( dat1, dat2, selCols, supCols2 = NULL, byC = NULL, useAll = FALSE, setRownames = TRUE, newSuff = c(".x", ".y"), silent = FALSE, debug = FALSE, callFrom = NULL )
dat1 |
matrix or data.frame for fusing |
dat2 |
matrix or data.frame for fusing |
selCols |
will be used to define columns to be used; optionally may be different for 'dat2' : define in 'supCols2' |
supCols2 |
if additional column-names should be extracted form dat2 |
byC |
(character) 'by' value used in |
useAll |
(logical) use all lines (will produce NAs when given identifyer not found un 2nd group of data) |
setRownames |
(logical) if |
newSuff |
(character) prefix (argument 'suffixes' in |
silent |
(logical) suppress messages |
debug |
(logical) display additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns a data.frame containing the merged columns
merge, merge 3 data.frames using mergeSelCol3
mat1 <- matrix(c(1:7,letters[1:7],11:17), ncol=3, dimnames=list(LETTERS[1:7],c("x1","x2","x3"))) mat2 <- matrix(c(1:6,c("b","a","e","f","g","k"), 31:36), ncol=3, dimnames=list(LETTERS[11:16],c("y1","x2","x3"))) mergeSelCol(mat1, mat2, selC=c("x2","x3"))mat1 <- matrix(c(1:7,letters[1:7],11:17), ncol=3, dimnames=list(LETTERS[1:7],c("x1","x2","x3"))) mat2 <- matrix(c(1:6,c("b","a","e","f","g","k"), 31:36), ncol=3, dimnames=list(LETTERS[11:16],c("y1","x2","x3"))) mergeSelCol(mat1, mat2, selC=c("x2","x3"))
successive merge of selected columns out of 3 matrix or data.frames. 'selCols' will be used to define columns to be used; optionally may be different for 'dat2' : define in 'supCols2'. Output-cols will get additions specified in newSuff (default '.x' and '.y')
mergeSelCol3( dat1, dat2, dat3, selCols, supCols2 = NULL, supCols3 = NULL, byC = NULL, useAll = FALSE, setRownames = TRUE, newSuff = c(".x", ".y", ".z"), silent = FALSE, debug = FALSE, callFrom = NULL )mergeSelCol3( dat1, dat2, dat3, selCols, supCols2 = NULL, supCols3 = NULL, byC = NULL, useAll = FALSE, setRownames = TRUE, newSuff = c(".x", ".y", ".z"), silent = FALSE, debug = FALSE, callFrom = NULL )
dat1 |
matrix or data.frame for fusing |
dat2 |
matrix or data.frame for fusing |
dat3 |
matrix or data.frame for fusing |
selCols |
will be used to define columns to be used; optionally may be different for 'dat2' : define in 'supCols2' |
supCols2 |
if additional column-names should be extracted form dat2 |
supCols3 |
if additional column-names should be extracted form dat3 |
byC |
(character) 'by' value used in |
useAll |
(logical) use all lines (will produce NAs when given identifyer not found un 2nd group of data) |
setRownames |
if |
newSuff |
(character) prefix (argument 'suffixes' in |
silent |
(logical) suppress messages |
debug |
(logical) display additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns a data.frame containing the merged columns
mat1 <- matrix(c(1:7,letters[1:7],11:17),ncol=3,dimnames=list(LETTERS[1:7],c("x1","x2","x3"))) mat2 <- matrix(c(1:6,c("b","a","e","f","g","k"),31:36), ncol=3, dimnames=list(LETTERS[11:16],c("y1","x2","x3"))) mat3 <- matrix(c(1:6,c("c","a","e","b","g","k"),51:56), ncol=3, dimnames=list(LETTERS[11:16],c("z1","x2","x3"))) mergeSelCol3(mat1, mat2, mat3, selC=c("x2","x3"))mat1 <- matrix(c(1:7,letters[1:7],11:17),ncol=3,dimnames=list(LETTERS[1:7],c("x1","x2","x3"))) mat2 <- matrix(c(1:6,c("b","a","e","f","g","k"),31:36), ncol=3, dimnames=list(LETTERS[11:16],c("y1","x2","x3"))) mat3 <- matrix(c(1:6,c("c","a","e","b","g","k"),51:56), ncol=3, dimnames=list(LETTERS[11:16],c("z1","x2","x3"))) mergeSelCol3(mat1, mat2, mat3, selC=c("x2","x3"))
This function allows merging for multiple named vectors (each element needs to be named).
Basically, all elements carrying the same name across different input-vectors will be aligned in the same column of the output (input-vectors appear as lines).
If vectors are not given using a name (see first example below), they will be names 'x.1' etc (see argument namePrefix).
mergeVectors( ..., namePrefix = "x.", NAto0 = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )mergeVectors( ..., namePrefix = "x.", NAto0 = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )
... |
all vectors that need to be merged |
namePrefix |
(character) prefix to numers used when vectors are not given with explicit names (second exammple) |
NAto0 |
(logical) optional replacemet of |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Note : The arguments 'namePrefix', 'NAto0', 'callFrom' and 'silent' must be given with full name to be recognized as such (and not get considered as vector for merging).
This function returns a matrix of merged values
merge (for two data.frames)
x1 <- c(a=1, b=11, c=21) x2 <- c(b=12, c=22, a=2) x3 <- c(a=3, d=43) mergeVectors(vect1=x1, vect2=x2, vect3=x3) x4 <- 41:44 # no names - not conform for merging mergeVectors(x1, x2, x3, x4)x1 <- c(a=1, b=11, c=21) x2 <- c(b=12, c=22, a=2) x3 <- c(a=3, d=43) mergeVectors(vect1=x1, vect2=x2, vect3=x3) x4 <- 41:44 # no names - not conform for merging mergeVectors(x1, x2, x3, x4)
mergeW2 povides flexible merging out of 'MArrayLM'-object (if found, won't consider any other input-data) or of separate vectors or matrixes.
The main idea was to have somthing not adding add'l lines as merge might do, but to stay within the frame of the 1st argument given, even when IDs are repeated,
so the output follows the order of the 1st argument, non-redundant IDs are created (orig IDs as new column).
If no 'MArrayLM'-object found: try to combine all elements of input '...', input-names must match predefined variants 'chInp'.
IDs given in 1st argument and not found in later arguments will be displayed as NA in the output matrix of data.frame.
Note : (non-data) arguments must be given with full name (so far no lazy evaluation, may conflict with names in 'inputNamesLst').
Note : special characters in colnames bound to give trouble.
Note : when no names given, mergeW2 will presume order of elements (names) from 'inputNamesLst'.
PROBLEM : error after xxMerg3 when several entries have matching (row)names but some entries match only partially (what to do : replace with NAs ??)
mergeW2( ..., nonRedundID = TRUE, convertDF = TRUE, selMerg = TRUE, inputNamesLst = NULL, noMatchPursue = TRUE, standColNa = FALSE, lastOfMultCols = c("p.value", "Lfdr"), duplTxtSep = "_", silent = FALSE, debug = FALSE, callFrom = NULL )mergeW2( ..., nonRedundID = TRUE, convertDF = TRUE, selMerg = TRUE, inputNamesLst = NULL, noMatchPursue = TRUE, standColNa = FALSE, lastOfMultCols = c("p.value", "Lfdr"), duplTxtSep = "_", silent = FALSE, debug = FALSE, callFrom = NULL )
... |
all data (vectors, matrixes or data.frames) intendes for merge |
nonRedundID |
(logical) if TRUE, allways add 1st column with non-redundant IDs (add anyway if non-redundant IDs found ) |
convertDF |
(logical) allows converting output in data.frame, add new heading col with non-red rownames & check which cols should be numeric |
selMerg |
(logical) if FALSE toggle to classic merge() (will give more rows in output in case of redundant names |
inputNamesLst |
(list) named list with character vectors (should be unique), search these names in input for extracting/merging elements use for 'lazy matching' when checking names of input, default : 7 groups ('Mvalue', 'Avalue','p.value','mouseInfo','Lfdr','link','filt') with common short versions |
noMatchPursue |
(logical) allows using entries where 0 names match (just as if no names given) |
standColNa |
(logical) if TRUE return standard colnames as defined in 'inputNamesLst' (ie 'chInp'), otherwise colnames as initially provided |
lastOfMultCols |
may specify input groups where only last col will be used/extracted |
duplTxtSep |
(character) separator for counting/denomiating multiple occurances of same name |
silent |
(logical) suppress messages |
debug |
(logical) for bug-tracking: more/enhanced messages and intermediate objects written in global name-space |
callFrom |
(character) allows easier tracking of message(s) produced |
matrix or data.frame of fused data
t1 <- 1:10; names(t1) <- letters[c(1:7,3:4,8)] t2 <- 20:11; names(t2) <- letters[c(1:7,3:4,8)] t3 <- 101:110; names(t3) <- letters[c(11:20)] t4 <- matrix(100:81,ncol=2,dimnames=list(letters[1:10],c("co1","co2"))) t5 <- cbind(t1=t1,t52=t1+20,t53=t1+30) t1; t2; t3; cbind(t1,t2) mergeW2(Mval=t1,p.value=t2,debug=FALSE)t1 <- 1:10; names(t1) <- letters[c(1:7,3:4,8)] t2 <- 20:11; names(t2) <- letters[c(1:7,3:4,8)] t3 <- 101:110; names(t3) <- letters[c(11:20)] t4 <- matrix(100:81,ncol=2,dimnames=list(letters[1:10],c("co1","co2"))) t5 <- cbind(t1=t1,t52=t1+20,t53=t1+30) t1; t2; t3; cbind(t1,t2) mergeW2(Mval=t1,p.value=t2,debug=FALSE)
This function aims to find the min distance (ie closest point) to any other x (numeric value), ie intra 'x' and returns matrix with 'index','value','dif','ppm','ncur','nbest','best'. At equal distance to lower & upper neighbour point, the upper (following) point is chosen (as single best). In case of multiple ex-aequo distance returns 1st of multiple, may be different at various repeats.
minDiff( x, digSig = 3, ppm = TRUE, initOrder = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )minDiff( x, digSig = 3, ppm = TRUE, initOrder = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )
x |
(numeric) vector to search minimum difference |
digSig |
number of significant digits, used for ratio or ppm column |
ppm |
(logical) display distance as ppm (1e6*diff/refValue, ie normalized difference eg as used in mass spectrometry), otherwise the ratio is given as : value(from 'x') / closestValue (from 'x') |
initOrder |
(logical) return matrix so that 'x' matches exactely 2nd col of output |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns a matrix
set.seed(2017); aa <- 100*c(0.1 +round(runif(20),2),0.53,0.53) minDiff(aa); minDiff(aa,initO=TRUE,ppm=FALSE); .minDif(unique(aa))set.seed(2017); aa <- 100*c(0.1 +round(runif(20),2),0.53,0.53) minDiff(aa); minDiff(aa,initO=TRUE,ppm=FALSE); .minDif(unique(aa))
This function runs moderated t-test from package limma on each line of data.
Note: This function requires the package limma from bioconductor being installed.
The limma contrast-matrix has to be read by column, the lines in the contrast-matrix containing '+1' will be compared to the '-1' lines, eg grpA-grpB .
Local false discovery rates (lfdr) estimations will be made using the CRAN-package fdrtool (if available).
moderTest2grp( dat, grp, limmaOutput = TRUE, addResults = c("lfdr", "FDR", "Mval", "means"), testOrientation = "=", silent = FALSE, debug = FALSE, callFrom = NULL )moderTest2grp( dat, grp, limmaOutput = TRUE, addResults = c("lfdr", "FDR", "Mval", "means"), testOrientation = "=", silent = FALSE, debug = FALSE, callFrom = NULL )
dat |
matrix or data.frame with rows for multiple (independent) tests, use ONLY with 2 groups; assumed as log2-data |
grp |
(factor) describes column-relationship of 'dat' (1st factor is considered as reference -> orientation of M-values !!) |
limmaOutput |
(logical) return full (or extended) MArrayLM-object from limma or 'FALSE' for only the (uncorrected) p.values |
addResults |
(character) types of results to add besides basic limma-output, data are assumed to be log2 ! (eg "lfdr" using fdrtool-package, "FDR" or "BH" for BH-FDR, "BY" for BY-FDR, "bonferroni" for Bonferroni-correction, "qValue" for lfdr by qvalue, "Mval", "means" or "nonMod" for non-moderated test and he equivaent all (other) multiple testing corrections chosen here) |
testOrientation |
(character) for one-sided test (">","greater" or "<","less"), NOTE : 2nd grp is considered control/reference, '<' will identify grp1 < grp2 |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns a limma-type object of class MArrayLM (which can be handeled like a list)
lmFit and the eBayes-family of functions in package limma, p.adjust
set.seed(2017); t8 <- matrix(round(rnorm(1520,10,0.4),2), ncol=8, dimnames=list(paste("l",1:190),c("AA1","BB1","CC1","DD1","AA2","BB2","CC2","DD2"))) t8[3:6,1:2] <- t8[3:6,1:2] +3 # augment lines 3:6 for AA1&BB1 t8[5:8,5:6] <- t8[5:8,5:6] +3 # augment lines 5:8 for AA2&BB2 (c,d,g,h should be found) t4 <- log2(t8[,1:4]/t8[,5:8]) ## Two-sided testing fit4 <- moderTest2grp(t4,gl(2,2)) # If you have limma installed we can now see further if(requireNamespace("limma")) { limma::topTable(fit4, coef=1, n=5)} # effect for 3,4,7,8 ## One-sided testing fit4in <- moderTest2grp(t4,gl(2,2), testO="<") # If you have limma installed we can now see further if(requireNamespace("limma")) { limma::topTable(fit4in, coef=1, n=5) }set.seed(2017); t8 <- matrix(round(rnorm(1520,10,0.4),2), ncol=8, dimnames=list(paste("l",1:190),c("AA1","BB1","CC1","DD1","AA2","BB2","CC2","DD2"))) t8[3:6,1:2] <- t8[3:6,1:2] +3 # augment lines 3:6 for AA1&BB1 t8[5:8,5:6] <- t8[5:8,5:6] +3 # augment lines 5:8 for AA2&BB2 (c,d,g,h should be found) t4 <- log2(t8[,1:4]/t8[,5:8]) ## Two-sided testing fit4 <- moderTest2grp(t4,gl(2,2)) # If you have limma installed we can now see further if(requireNamespace("limma")) { limma::topTable(fit4, coef=1, n=5)} # effect for 3,4,7,8 ## One-sided testing fit4in <- moderTest2grp(t4,gl(2,2), testO="<") # If you have limma installed we can now see further if(requireNamespace("limma")) { limma::topTable(fit4in, coef=1, n=5) }
This function runs (selected or all) pairwise combinations of moderated t-tests from package 'limma' on each line of data against. Note: This function requires the package limma from bioconductor. The limma contrast-matrix has to be read by column, the lines in the contrast-matrix containing '+1' will be compared to the '-1' lines, eg grpA-grpB .
moderTestXgrp( dat, grp, useComparison = NULL, limmaOutput = TRUE, addResults = c("lfdr", "FDR", "Mval", "means"), testOrientation = "=", sep = NULL, silent = FALSE, debug = FALSE, callFrom = NULL )moderTestXgrp( dat, grp, useComparison = NULL, limmaOutput = TRUE, addResults = c("lfdr", "FDR", "Mval", "means"), testOrientation = "=", sep = NULL, silent = FALSE, debug = FALSE, callFrom = NULL )
dat |
matrix or data.frame with rows for multiple (independent) tests, use ONLY with 2 groups; assumed as log2-data !!! |
grp |
(factor) describes column-relationship of 'dat' (1st factor is considered as reference -> orientation of M-values !!) |
useComparison |
(numeric, character or matrix) optional way to indicate which pairwise comparisons should be performed :
if |
limmaOutput |
(logical) return full (or extended) MArrayLM-object from limma or 'FAlSE' for only the (uncorrected) p.values |
addResults |
(character) types of results to add besides basic limma-output, data are assumed to be log2 ! (eg "lfdr" using fdrtool-package, "FDR" or "BH" for BH-FDR, "BY" for BY-FDR, "bonferroni" for Bonferroni-correction, "qValue" for lfdr by qvalue, "Mval", "means" or "nonMod" for non-moderated test and he equivaent all (other) multiple testing corrections chosen here) |
testOrientation |
(character) for one-sided test (">","greater" or "<","less"), NOTE : 2nd grp is considered control/reference, '<' will identify grp1 < grp2 |
sep |
(character) optional custom choice for separator for column-names of pairwise comparisons (if |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
When multiple pairwise comparisons will be run, first a global linear model will be estimated and the particular pairwise comparisons will then be performed using a contrast-matrix. This process is described with the bioconductor package limma which is used underneith.
By default (useComparison=NULL), the first of all possible pairwise comparisons will be run.
If you would like to run all comparisons, plase set useComparison="all".
Besides, it is also possible to custom choose which comparisons should be run (and which order of sample/reference) via the argument useComparison using
the character vector '–' as separator for the two groups of samples (referring to argument grp) to be compared.
This will be interpreted as 'sample–reference' (additional space around the separator, if present, will be removed), thus the second element will be used as reference.
Furthermore, the argument useComparison may be a matrix of 2 columns (for sample and reference) where each line represents a pairwise comparison that should be run.
As effort for compatibility to previous versions and compatibility to standard writing in limma the group-separator '-' in useComparison has limited support :
This (single character) separator will be internally converted to '–' and in absence of '-' in argument grp, output will have the initial (single character) separator '-'.
Concerning the separator used when reporting results for pairwise comparisons :
If argument grp contains any '-', comparisons of groups will always (!) get reported using '–' as separator to avoid any confusion.
In case useComparison is a matrix, the reported comparisons will have '-' if grp does not contain as well any '-', otherwise '–' will be used
(to support compatibility with results from limma).
Please note, that in the output of this function the Benjamini-Hochberg (BH) adjusted p-values are called 'FDR' (see argument addResults).
the output caontains a list-element named setup summarizing the global setup as captured (names of groups of samples), including the names of the pairwise combinations that were tested.
This function returns a limma-type MA-object (which can be handeled like a list), or when problems are encountered NULL
lmFit and the eBayes-family of functions in package limma;
getPWseparator and convPairwiseSetup for orgnizing experimental setup; moderTest2grp for simplified single comparisons (with much fewer options/flexibility)
grp3 <- factor(rep(LETTERS[c(3,1,4)],c(2,3,3))) set.seed(2017); t8 <- matrix(round(rnorm(208*8,10,0.4),2), ncol=8, dimnames=list(paste(letters[],rep(1:8,each=26),sep=""), paste0(grp3, c(1:2,1:3,1:3)))) t8[3:6,1:2] <- t8[3:6,1:2] +3 # augment lines 3:6 (c-f) t8[5:8,c(1:2,6:8)] <- t8[5:8,c(1:2,6:8)] -1.5 # lower lines t8[6:7,3:5] <- t8[6:7,3:5] +2.2 # augment lines ## expect to find C/A in c,d,g, (h) ## expect to find C/D in c,d,e,f ## expect to find A/D in f,g,(h) test8 <- moderTestXgrp(t8, grp3) ## Custom choice of what to compare test8b <- moderTestXgrp(t8, grp3, useComparison=c("D-A","C-A")) head(test8b$FDR) head(test8b$Mval) ## Custom choice as matrix comp4 <- matrix(LETTERS[c(4,3,3,1)], ncol=2) test4 <- moderTestXgrp(t8, grp3, useComparison=comp4) ## Names of pairwise comparisons performed test4$setup$concat ## One can also use functions from package limma to see more library(limma) topTable(test8b, n=5)grp3 <- factor(rep(LETTERS[c(3,1,4)],c(2,3,3))) set.seed(2017); t8 <- matrix(round(rnorm(208*8,10,0.4),2), ncol=8, dimnames=list(paste(letters[],rep(1:8,each=26),sep=""), paste0(grp3, c(1:2,1:3,1:3)))) t8[3:6,1:2] <- t8[3:6,1:2] +3 # augment lines 3:6 (c-f) t8[5:8,c(1:2,6:8)] <- t8[5:8,c(1:2,6:8)] -1.5 # lower lines t8[6:7,3:5] <- t8[6:7,3:5] +2.2 # augment lines ## expect to find C/A in c,d,g, (h) ## expect to find C/D in c,d,e,f ## expect to find A/D in f,g,(h) test8 <- moderTestXgrp(t8, grp3) ## Custom choice of what to compare test8b <- moderTestXgrp(t8, grp3, useComparison=c("D-A","C-A")) head(test8b$FDR) head(test8b$Mval) ## Custom choice as matrix comp4 <- matrix(LETTERS[c(4,3,3,1)], ncol=2) test4 <- moderTestXgrp(t8, grp3, useComparison=comp4) ## Names of pairwise comparisons performed test4$setup$concat ## One can also use functions from package limma to see more library(limma) topTable(test8b, n=5)
This functions allows multiple types of replacements of entire character elements in simple vector, matrix or data.frame. In addtion, the result may be optionally directly transformed to logical or numeric
multiCharReplace( mat, repl, convTo = NULL, silent = FALSE, debug = TRUE, callFrom = NULL )multiCharReplace( mat, repl, convTo = NULL, silent = FALSE, debug = TRUE, callFrom = NULL )
mat |
(character vector, matrix or data.frame) main data |
repl |
(matrix or list) tells what to replace by what: If matrix the 1st oolumn will be considered as 'old' and the 2nd as 'replaceBy'; if named list, the names of the list-elements will be consdered as 'replaceBy' |
convTo |
(character) optional conversion of content to 'numeric' or 'logical' |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns an object of same dimension as input (with replaced content)
x1 <- c("ab","bc","cd","efg","ghj") multiCharReplace(x1, cbind(old=c("bc","efg"), new=c("BBCC","EF"))) x2 <- c("High","n/a","High","High","Low") multiCharReplace(x2, cbind(old=c("n/a","Low","High"), new=c(NA,FALSE,TRUE)),convTo="logical") # works also to replace numeric content : x3 <- matrix(11:16, ncol=2) multiCharReplace(x3, cbind(12:13,112:113))x1 <- c("ab","bc","cd","efg","ghj") multiCharReplace(x1, cbind(old=c("bc","efg"), new=c("BBCC","EF"))) x2 <- c("High","n/a","High","High","Low") multiCharReplace(x2, cbind(old=c("n/a","Low","High"), new=c(NA,FALSE,TRUE)),convTo="logical") # works also to replace numeric content : x3 <- matrix(11:16, ncol=2) multiCharReplace(x3, cbind(12:13,112:113))
This function allows convenient matching of multi-to-multi relationships between two objects/vectors.
It was designed for finding common elements in multiple to multiple matching situations (eg when comparing c("aa; bb", "cc") to c("bb; ab","dd"),
ie to find 'bb' as matching between both objects).
multiMatch( x, y, sep = "; ", sep2 = NULL, method = "byX", silent = FALSE, debug = FALSE, callFrom = NULL )multiMatch( x, y, sep = "; ", sep2 = NULL, method = "byX", silent = FALSE, debug = FALSE, callFrom = NULL )
x |
(vector or list) first object to compare; if vector, the (partially) concatenated identifyers (will be split using separator |
y |
(vector or list) second object to compare; if vector, the (partially) concatenated identifyers (will be split using separator |
sep |
(character, length=1) separator used to split concatenated identifyers (if |
sep2 |
(character, length=1) optional separator used when |
method |
(character) mode of operation: 'asIndex' to return index of y (those hwo have matches) with names of x (which x are the correpsonding match) |
silent |
(logical) suppress messages |
debug |
(logical) display additional messages for debugging |
callFrom |
(character) allow easier tracking of message(s) produced |
method='byX' .. returns data.frame with view oriented towards entries of x: character column x for entire content of x; integer column x.Ind for index of x;
character column TagBest for most frequent matching isolated tag/ID; integer column y.IndBest index of most frequent matching y;
character column y.IndAll index for all y matching any of the tags;
character column y.Match for entire content of best matching y;
character column y.Adj for y adjusted to best matching y for easier subsequent perfect matching.
method=c("byX","filter") .. combinded argument to keep only lines with any matches
method='byTag' .. returns matrix (of integers) from view of isolated tags from x (a separate line for each tag from x matching to y);
method=c("byTag","filter") ..if combined as arguments, this will return a data.frame for all unique tags with any matches between x and y, with
additional colunms x.AllInd for all matching x-indexes, y.IndBest best matching y index; x.n for number of different x conatining this tag;
y.AllInd for all matching y-indexes
method='adjustXtoY' .. returns vector with x adjusted to y, ie those elements of x matching are replace by the exact corresponding term of y.
method=NULL .. If no term matching the options shown above is given, another version of 'asIndex' is returned, but indexes to y _after_ spliting by sep.
Again, this method can be filtered by using method="filter" to focus on the best matches to x.
matrix, data.frame or list with matching results depending on method chosen
aa <- c("m","k", "j; aa", "m; aa; bb; o; ee", "n; dd; cc", "aa", "cc") bb <- c("dd; r", "aa", "ee; bb; q; cc", "p; cc") (match1 <- multiMatch(aa, bb, method=NULL)) # match bb to aa (match2 <- multiMatch(aa, bb, method="byX")) # match bb to aa (match3 <- multiMatch(aa, bb, method="byTag")) # match bb to aa (match4 <- multiMatch(aa, bb, method=c("byTag","filter"))) # match bb to aaaa <- c("m","k", "j; aa", "m; aa; bb; o; ee", "n; dd; cc", "aa", "cc") bb <- c("dd; r", "aa", "ee; bb; q; cc", "p; cc") (match1 <- multiMatch(aa, bb, method=NULL)) # match bb to aa (match2 <- multiMatch(aa, bb, method="byX")) # match bb to aa (match3 <- multiMatch(aa, bb, method="byTag")) # match bb to aa (match4 <- multiMatch(aa, bb, method=c("byTag","filter"))) # match bb to aa
This function removes NAs from input vector, in contrast to na.omit this function has no slot for removed elements.
naOmit(x, silent = FALSE, debug = FALSE, callFrom = NULL)naOmit(x, silent = FALSE, debug = FALSE, callFrom = NULL)
x |
(vector or matrix) data to check & remove |
silent |
(logical) suppress messages if |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
Resulting objects from naOmit are smaller in size and subsequent code execution (on large vectors) may be faster (in particular if many NAs get encountered).
Note : This function behaves differently to na.omit with input other than plain vectors. Will not work with data.frames !
This function returns a vector without NAs (matrix input will be transformed to vector). Returns NULL if input consists only of NAs.
na.fail, na.omit
aA <- c(11:13,NA,10,NA); naOmit(aA)aA <- c(11:13,NA,10,NA); naOmit(aA)
This function determines number of fragments /entry within range of 'sizeRa' (numeric,length=2) when cutting after 'cutAt'
nFragments( protSeq, cutAt, sizeRa, silent = FALSE, debug = FALSE, callFrom = NULL )nFragments( protSeq, cutAt, sizeRa, silent = FALSE, debug = FALSE, callFrom = NULL )
protSeq |
(character) text to be cut |
cutAt |
(character) position to cut |
sizeRa |
(numeric,length=2) min and max size to consider |
silent |
(logical) suppress messages if |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
This function returns a numeric vector with number of fragments for each entry 'protSeq' (names are 'protSeq')
cutAtMultSites, simple version {nFragments0} (no size-range)
tmp <- "MSVSREDSCELDLVYVTERIIAVSFPSTANEENFRSNLREVAQMLKSKHGGNYLLFNLSERRPDITKLHAKVLEFGWPDLHTPALEKI" nFragments(c(tmp,"ojioRij"),c("R","K"),c(4,31))tmp <- "MSVSREDSCELDLVYVTERIIAVSFPSTANEENFRSNLREVAQMLKSKHGGNYLLFNLSERRPDITKLHAKVLEFGWPDLHTPALEKI" nFragments(c(tmp,"ojioRij"),c("R","K"),c(4,31))
This function tells the number of fragments/entry when cutting after 'cutAt'
nFragments0(protSeq, cutAt, silent = FALSE, debug = FALSE, callFrom = NULL)nFragments0(protSeq, cutAt, silent = FALSE, debug = FALSE, callFrom = NULL)
protSeq |
(character) text to be cut |
cutAt |
(integer) position to cut |
silent |
(logical) suppress messages if |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
This function returns a numeric vector with number of fragments for each entry 'protSeq' (names are 'protSeq')
more elaborate {nFragments}; cutAtMultSites
tmp <- "MSVSRTMEDSCELDLVYVTERIIAVSFPSTANEENFRSNLREVAQMLKSKHGGNYLLFNLSERRPDITKLHAKVLEFGWPDLHTPALEKI" nFragments0(c(tmp,"ojioRij"),c("R","K"))tmp <- "MSVSRTMEDSCELDLVYVTERIIAVSFPSTANEENFRSNLREVAQMLKSKHGGNYLLFNLSERRPDITKLHAKVLEFGWPDLHTPALEKI" nFragments0(c(tmp,"ojioRij"),c("R","K"))
nNonNumChar counts number of non-numeric characters.
Made for positive non-scientific values (eg won't count neg-sign, neither Euro comma ',')
nNonNumChar(txt)nNonNumChar(txt)
txt |
character vector to be treated |
This function returns a numeric vector with numer of non-numeric characters (ie not '.' or 0-9))
nNonNumChar("a1b "); sapply(c("aa","12ab","a1b2","12","0.5"), nNonNumChar)nNonNumChar("a1b "); sapply(c("aa","12ab","a1b2","12","0.5"), nNonNumChar)
nonAmbiguousMat makes values of matrix 'mat' in col 'byCol' unique.
nonAmbiguousMat( mat, byCol, uniqOnly = FALSE, asList = FALSE, nameMod = "amb_", silent = TRUE, debug = FALSE, callFrom = NULL )nonAmbiguousMat( mat, byCol, uniqOnly = FALSE, asList = FALSE, nameMod = "amb_", silent = TRUE, debug = FALSE, callFrom = NULL )
mat |
numeric or character matrix (or data.frame), column specified by 'byCol' must be/will be used as.numeric, 1st column of 'mat' will be considered like index & used for adding prefix 'nameMod' (unless byCol=1, then 2nd col will be used) |
byCol |
(character or integer-index) column by which ambiguousity will be tested |
uniqOnly |
(logical) if =TRUE return unique only, if =FALSE return unique and single representative of non-unique values (with ” added to name), selection of representative of repeated: first (of sorted) or middle if >2 instances |
asList |
(logical) return result as list |
nameMod |
(character) prefix added to 1st column of 'mat' (expect 'by') for indicating non-unique/ambiguous values |
silent |
(logical) suppress messages |
debug |
(logical) for bug-tracking: more/enhanced messages and intermediate objects written in global name-space |
callFrom |
(character) allows easier tracking of message(s) produced |
sorted non-ambigous numeric vector (or list if 'asList'=TRUE and 'uniqOnly'=FALSE)
for non-numeric use firstOfRepeated - but 1000x much slower !; get1stOfRepeatedByCol
set.seed(2017); mat2 <- matrix(c(1:100,round(rnorm(200),2)),ncol=3, dimnames=list(1:100,LETTERS[1:3])); head(mat2U <- nonAmbiguousMat(mat2,by="B",na="_",uniqO=FALSE),n=15) head(get1stOfRepeatedByCol(mat2,sortB="B",sortS="B"))set.seed(2017); mat2 <- matrix(c(1:100,round(rnorm(200),2)),ncol=3, dimnames=list(1:100,LETTERS[1:3])); head(mat2U <- nonAmbiguousMat(mat2,by="B",na="_",uniqO=FALSE),n=15) head(get1stOfRepeatedByCol(mat2,sortB="B",sortS="B"))
Thios function transfomrmes a vector of (named) numeric values x into unique.
Note: for non-numeric use the function firstOfRepeated - but 1000x slower !
Return sorted non-ambigous numeric vector (or list if 'asList'=TRUE and 'uniqOnly'=FASLSE)
nonAmbiguousNum( x, uniqOnly = FALSE, asList = FALSE, nameMod = "amb_", silent = FALSE, debug = FALSE, callFrom = NULL )nonAmbiguousNum( x, uniqOnly = FALSE, asList = FALSE, nameMod = "amb_", silent = FALSE, debug = FALSE, callFrom = NULL )
x |
(numeric) main input |
uniqOnly |
(logical) if=TRUE return unique only, if =FALSE return unique and single representative of non-unique values (with ” added to name), selection of representative of repeated: first (of sorted) or middle if >2 instances |
asList |
(logical) return list |
nameMod |
(character) text to add in case on ambiguous values, default="amb_" |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
sorted non-ambigous numeric vector (or list if 'asList'=TRUE and 'uniqOnly'=FALSE)
firstOfRepeated for non-numeric use (much slower !!!), duplicated
set.seed(2017); aa <- round(rnorm(100),2); names(aa) <- 1:length(aa) str(nonAmbiguousNum(aa)) str(nonAmbiguousNum(aa,uniq=FALSE,asLi=TRUE))set.seed(2017); aa <- round(rnorm(100),2); names(aa) <- 1:length(aa) str(nonAmbiguousNum(aa)) str(nonAmbiguousNum(aa,uniq=FALSE,asLi=TRUE))
nonredDataFrame filters 'x' (list of char-vectors or char-vector) for elements unique (to 'ref' or if NULL to all 'x') and of character length.
May be used for different 'accession' for same pep sequence (same 'peptide_id').
Note : made for treating data.frames, may be slightly slower than matrix equivalent
nonredDataFrame( dataFr, useCol = c(pepID = "peptide_id", protID = "accession", seq = "sequence", mod = "modifications"), sepCollapse = "//", callFrom = NULL )nonredDataFrame( dataFr, useCol = c(pepID = "peptide_id", protID = "accession", seq = "sequence", mod = "modifications"), sepCollapse = "//", callFrom = NULL )
dataFr |
(data.frame) main inpput |
useCol |
(character,length=2) comlumn names of 'dataFr' to use : 1st value designates where redundant values should be gathered; 2nd value designes column of which information should be concatenated |
sepCollapse |
(character) conatenation symbol |
callFrom |
(character) allow easier tracking of messages produced |
This function returns a data.frame of filtered (fewer lines) with additional 2 columns 'nSamePep' (number of redundant entries) and 'concID' (concatenated content)
combineRedBasedOnCol, correctToUnique, unique
df1 <- data.frame(cbind(xA=letters[1:5], xB=c("h","h","f","e","f"), xC=LETTERS[1:5])) nonredDataFrame(df1, useCol=c("xB","xC"))df1 <- data.frame(cbind(xA=letters[1:5], xB=c("h","h","f","e","f"), xC=LETTERS[1:5])) nonredDataFrame(df1, useCol=c("xB","xC"))
This function reduces complexity of matrix (or data.frame) if multiple consectuive (!) lines with same values. Return matrix (or data.frame) without repeated lines (keep 1st occurance)
nonRedundLines(dat, silent = FALSE, debug = FALSE, callFrom = NULL)nonRedundLines(dat, silent = FALSE, debug = FALSE, callFrom = NULL)
dat |
(matrix or data.frame) main input |
silent |
(logical) suppress messages if |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
This function returns a matrix (or data.frame) without repeated lines (keep 1st occurance)..
firstLineOfDat, firstOfRepLines, findRepeated, firstOfRepeated, get1stOfRepeatedByCol, combineRedBasedOnCol, correctToUnique
mat2 <- matrix(rep(c(1,1:3,3,1),2),ncol=2,dimnames=list(letters[1:6],LETTERS[1:2])) nonRedundLines(mat2)mat2 <- matrix(rep(c(1,1:3,3,1),2),ncol=2,dimnames=list(letters[1:6],LETTERS[1:2])) nonRedundLines(mat2)
Generic normalization of 'dat' (by columns), multiple methods may be applied. The choice of normalization procedures must be done with care, plotting the data before and after normalization may be critical to understandig the initial data structure and the effect of the procedure applied. Inappropriate methods chosen may render interpretation of (further) results incorrect.
normalizeThis( dat, method = c("mean", "average", "median", "trimMean", "rowNormalize", "standardize", "slope", "twoPointSlope", "exponent", "vsn", "none", "NULL"), refLines = NULL, refGrp = NULL, mode = c("proportional", "additive", "linear", "lin", "logarithmic", "log"), trimFa = NULL, minQuant = NULL, sparseLim = 0.4, nCombin = 3, omitNonAlignable = FALSE, maxFact = 10, quantFa = NULL, expFa = NULL, silent = FALSE, debug = FALSE, callFrom = NULL )normalizeThis( dat, method = c("mean", "average", "median", "trimMean", "rowNormalize", "standardize", "slope", "twoPointSlope", "exponent", "vsn", "none", "NULL"), refLines = NULL, refGrp = NULL, mode = c("proportional", "additive", "linear", "lin", "logarithmic", "log"), trimFa = NULL, minQuant = NULL, sparseLim = 0.4, nCombin = 3, omitNonAlignable = FALSE, maxFact = 10, quantFa = NULL, expFa = NULL, silent = FALSE, debug = FALSE, callFrom = NULL )
dat |
matrix or data.frame of data to get normalized |
method |
(character) may be "mean","median","NULL","none", "trimMean", "rowNormalize", "slope", "exponent", "twoPointSlope", "vsn"; When |
refLines |
(NULL or numeric) allows to consider only specific lines of 'dat' when determining normalization factors (all data will be normalized) |
refGrp |
Only the columns indicated will be used as reference, default all columns (integer or colnames) |
mode |
(character) may be "proportional", "additive" (for log2 data);
decide if normalization factors will be applied as multiplicative (proportional) or additive; for log2-omics data |
trimFa |
(numeric, length=1) additional parameters for trimmed mean |
minQuant |
(numeric) only used with |
sparseLim |
(integer) only used with |
nCombin |
(NULL or integer) only used with |
omitNonAlignable |
(logical) only used with |
maxFact |
(numeric, length=2) only used with |
quantFa |
(numeric, length=2) additional parameters for quantiles to use with method='slope' |
expFa |
(numeric, length=1) additional parameters for method='exponent' |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
In most cases of treating 'Omics'-data one works with the hypothesis that there are no global changes in the structure of all data/columns
Under this htpothesis it is very common to assume the the median (via the argument method) of all samples (ie columns) should remain constant.
For examples samples/columns with less signal will be considered as having received 'accidentally' less material (eg due to the imprecision when transfering very small amounts of liquid samples).
In consequence, a sample having received only 95
Thus, all measures will be multiplied by 1/0.95 (apr 1.053) to compensate for supposed lack of staring material.
LOG-SCALE : With the analysis of 'Omics'-data it is very common to work with data on log-scale.
In this case the argument mode should be set to additive (or log or logarithmic).
At normalization a constant factor will be added (or subtracted) using this mode. This corresponds to a multiplicative factor on regular scale.
Please note that (at this point) the methods 'slope', 'exponent', 'twoPointSlope' and 'vsn' don't distinguish between additive and proportional modes, but take take the data 'as is'
(you may look at the original documenation for more details, see exponNormalize, scaleXY or adjBy2ptReg, justvsn).
Normalization using method="rowNormalize" runs rowNormalize from this package.
In this case, the working hypothesis is, that all values in each row are expected to be the same.
This method could be applied when all series of values (ie columns) are replicate measurements of the same sample.
THere is also an option for treating sparse data (see argument sparseLim), which may, hovere, consume much more comptational ressources,
in particular, when the value nCombin is low (compared to the number of samples/columns).
Normalization using method="standardize" runs scale resulting in a matrix where column-means are set to 0 (or very close to 0)
and sd et 1, standardization by columns. With this method additive or proportional mode give the same output.
Results from this methid should be interpreted with caution, since the absolute values are not any more considered.
Therefor this approach is rather oriented for comparing profiles (no matter how important changes are on an absolute scale)
Normalization using method="vsn" runs justvsn from vsn
(this requires a minimum of 42 rows of input-data and having the Bioconductor package vsn installed).
Note : Depending on the procedure chosen, the normalized data may appear on a different scale.
This function returns a matrix of normalized data (same dimensions as input)
rowNormalize, exponNormalize, scaleXY, adjBy2ptReg, justvsn
set.seed(2015); rand1 <- round(runif(300)+rnorm(300,0,2),3) dat1 <- cbind(ser1=round(100:1+rand1[1:100]), ser2=round(1.2*(100:1+rand1[101:200])-2), ser3=round((100:1 +rand1[201:300])^1.2-3)) dat1 <- cbind(dat1, ser4=round(dat1[,1]^seq(2,5,length.out=100)+rand1[11:110],1)) dat1[dat1 <1] <- NA summary(dat1) dat1[c(1:5,50:54,95:100),] no1 <- normalizeThis(dat1, refGrp=1:3, meth="mean") no2 <- normalizeThis(dat1, refGrp=1:3, meth="trimMean", trim=0.4) no3 <- normalizeThis(dat1, refGrp=1:3, meth="median") no4 <- normalizeThis(dat1, refGrp=1:3, meth="slope", quantFa=c(0.2,0.8)) dat1[c(1:10,91:100),] cor(dat1[,3],rowMeans(dat1[,1:2],na.rm=TRUE), use="complete.obs") # high cor(dat1[,4],rowMeans(dat1[,1:2],na.rm=TRUE), use="complete.obs") # bad cor(dat1[c(1:10,91:100),4],rowMeans(dat1[c(1:10,91:100),1:2],na.rm=TRUE),use="complete.obs") cor(dat1[,3],rowMeans(dat1[,1:2],na.rm=TRUE)^ (1/seq(2,5,length.out=100)),use="complete.obs")set.seed(2015); rand1 <- round(runif(300)+rnorm(300,0,2),3) dat1 <- cbind(ser1=round(100:1+rand1[1:100]), ser2=round(1.2*(100:1+rand1[101:200])-2), ser3=round((100:1 +rand1[201:300])^1.2-3)) dat1 <- cbind(dat1, ser4=round(dat1[,1]^seq(2,5,length.out=100)+rand1[11:110],1)) dat1[dat1 <1] <- NA summary(dat1) dat1[c(1:5,50:54,95:100),] no1 <- normalizeThis(dat1, refGrp=1:3, meth="mean") no2 <- normalizeThis(dat1, refGrp=1:3, meth="trimMean", trim=0.4) no3 <- normalizeThis(dat1, refGrp=1:3, meth="median") no4 <- normalizeThis(dat1, refGrp=1:3, meth="slope", quantFa=c(0.2,0.8)) dat1[c(1:10,91:100),] cor(dat1[,3],rowMeans(dat1[,1:2],na.rm=TRUE), use="complete.obs") # high cor(dat1[,4],rowMeans(dat1[,1:2],na.rm=TRUE), use="complete.obs") # bad cor(dat1[c(1:10,91:100),4],rowMeans(dat1[c(1:10,91:100),1:2],na.rm=TRUE),use="complete.obs") cor(dat1[,3],rowMeans(dat1[,1:2],na.rm=TRUE)^ (1/seq(2,5,length.out=100)),use="complete.obs")
This function extracts a pair of numeric values out of a vector or colnames (from a matrix).
This is useful when pairwise comparisons are concatenated like '10c-100c', return matrix with 'index'=selComp, log2rat and both numeric.
Additional white space or character text can be removed via the argument stripTxt.
Of course, the separator sep needs to be specified and should not be included to 'stripTxt'.
numPairDeColNames( dat, selComp = NULL, stripTxt = NULL, sep = "-", columLabel = "conc", sortByAbsRatio = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )numPairDeColNames( dat, selComp = NULL, stripTxt = NULL, sep = "-", columLabel = "conc", sortByAbsRatio = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )
dat |
(matrix or data.frame) main input |
selComp |
(character) the column index selected |
stripTxt |
(character, max length=2) text to ignore, if NULL heading letter and punctuation characters will be removed; default will remove all letters (and following spaces) |
sep |
(character, length=1) separator between pair of numeric values to extract |
columLabel |
(character) column labels in output |
sortByAbsRatio |
(logical) optional sorting of output by (absolute) log-ratios (most extreme ratios on top) |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns a matrix
strsplit and help on regex
## composed column names mat1 <- matrix(1:8, nrow=2, dimnames=list(NULL, paste0(1:4,"-",6:9))) numPairDeColNames(mat1) numPairDeColNames(colnames(mat1)) ## works also with simple numeric column names mat2 <- matrix(1:8, nrow=2, dimnames=list(NULL, paste0("a",6:9))) numPairDeColNames(mat2)## composed column names mat1 <- matrix(1:8, nrow=2, dimnames=list(NULL, paste0(1:4,"-",6:9))) numPairDeColNames(mat1) numPairDeColNames(colnames(mat1)) ## works also with simple numeric column names mat2 <- matrix(1:8, nrow=2, dimnames=list(NULL, paste0("a",6:9))) numPairDeColNames(mat2)
This function orders lines of matrix mat according to a (character) reference vector ref.
To do so, all columns of mat will be considered to use the first column from left with the best (partial) matching results.
This function first looks for unambiguous perfect matches, and if not found successive rounds of more elaborte partial matching will be engaged:
In case of no perfect matches found, grep of ref on all columns of mat and/or grep of all columns of mat on ref (ie 'reverse grep') will be applied (finally a 'two way grep' approach).
Until a perfect match is found each element of ref will be tested on mat and inversely (for each column) each element of mat will be tested on ref.
The approach with the best number of (unique) matches will be chosen. In case of one-to-many matches, it will be tried to use most complete lines (see also last example).
orderMatrToRef( mat, ref, addRef = TRUE, listReturn = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )orderMatrToRef( mat, ref, addRef = TRUE, listReturn = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )
mat |
(matrix, data.frame) main input of which rows should get re-ordered according to a (character) reference vector |
ref |
(character) reference imposing new order |
addRef |
(logical) add |
listReturn |
(logical) allows retrieving more information in form of list |
silent |
(logical) suppress messages |
debug |
(logical) display additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns, depending on listReturn, either the input-matrix in new order or a list with $mat (the input matrix in new order), $grep (matched matrix) and $col indicating the colum of mat finally used
for basic ordering see match; checkGrpOrder for testing each line for expected order, checkStrictOrder to check for strict (ascending or descending) order
mat1 <- matrix(paste0("__",letters[rep(c(1,1,2,2,3),3) +rep(0:2,each=5)], rep(1:5)), ncol=3) orderMatrToRef(mat1, paste0(letters[c(3,4,5,3,4)],c(1,3,5,2,4))) mat2 <- matrix(paste0("__",letters[rep(c(1,1,2,2,3),3) +rep(0:2,each=5)], c(rep(1:5,2),1,1,3:5 )), ncol=3) orderMatrToRef(mat2, paste0(letters[c(3,4,5,3,4)],c(1,3,5,1,4))) mat3 <- matrix(paste0(letters[rep(c(1,1,2,2,3),3) +rep(0:2,each=5)], c(rep(1:5,2),1,1,3,3,5 )), ncol=3) orderMatrToRef(mat3, paste0("__",letters[c(3,4,5,3,4)],c(1,3,5,1,3)))mat1 <- matrix(paste0("__",letters[rep(c(1,1,2,2,3),3) +rep(0:2,each=5)], rep(1:5)), ncol=3) orderMatrToRef(mat1, paste0(letters[c(3,4,5,3,4)],c(1,3,5,2,4))) mat2 <- matrix(paste0("__",letters[rep(c(1,1,2,2,3),3) +rep(0:2,each=5)], c(rep(1:5,2),1,1,3:5 )), ncol=3) orderMatrToRef(mat2, paste0(letters[c(3,4,5,3,4)],c(1,3,5,1,4))) mat3 <- matrix(paste0(letters[rep(c(1,1,2,2,3),3) +rep(0:2,each=5)], c(rep(1:5,2),1,1,3,3,5 )), ncol=3) orderMatrToRef(mat3, paste0("__",letters[c(3,4,5,3,4)],c(1,3,5,1,3)))
Organize array of all data ('arrIn', long table) into list of (replicate-)arrays (of similar type/layout) based on dimension number 'byDim' of 'arrIn' (eg 2nd or 3rd dim).
Argument inspNChar defines the number of characters to consider, so if the beginning of names is the same they will be separated as list of multiple arrays.
Default will search for '_' separator or trim from end if not found in the relevant dimnames
organizeAsListOfRepl( arrIn, inspNChar = 0, byDim = 3, silent = TRUE, debug = FALSE, callFrom = NULL )organizeAsListOfRepl( arrIn, inspNChar = 0, byDim = 3, silent = TRUE, debug = FALSE, callFrom = NULL )
arrIn |
(array) main input |
inspNChar |
(interger) if inspNChar=0 the array-names (2nd dim of 'arrIn') will be cut before last '_' |
byDim |
(integer, length=1) dimension number along which data will be split in separate elements (considering the first inspNChar characters) |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns a list of arrays (typically 1st and 2nd dim for specific genes/objects, 3rd for different measures associated with)
arr1 <- array(1:24,dim=c(4,3,2),dimnames=list(c(LETTERS[1:4]), paste("col",1:3,sep=""), c("ch1","ch2"))) organizeAsListOfRepl(arr1)arr1 <- array(1:24,dim=c(4,3,2),dimnames=list(c(LETTERS[1:4]), paste("col",1:3,sep=""), c("ch1","ch2"))) organizeAsListOfRepl(arr1)
This function allows accessing the most recent counts of package downloads availabale on http://www.datasciencemeta.com/rpackages, obtaining rank quantiles and to compare (multiple) given packages to the bulk data, optionally a plot can be drawn.
packageDownloadStat( queryPackages = c("wrMisc", "wrProteo", "cif", "bcv", "FinCovRegularization"), countUrl = "http://www.datasciencemeta.com/rpackages", refQuant = (1:10)/10, options = c("naOmit", "sort"), figure = TRUE, log = "", silent = FALSE, callFrom = NULL, debug = FALSE )packageDownloadStat( queryPackages = c("wrMisc", "wrProteo", "cif", "bcv", "FinCovRegularization"), countUrl = "http://www.datasciencemeta.com/rpackages", refQuant = (1:10)/10, options = c("naOmit", "sort"), figure = TRUE, log = "", silent = FALSE, callFrom = NULL, debug = FALSE )
queryPackages |
(character or integer) package names of interest, if |
countUrl |
(character) the url where the dayly counts ara available |
refQuant |
(numeric) add reference quantile values to output matrix |
options |
(character) additional seetings : use 'naOmit' to remove NA-lines from output (package-names not found in 'countUrl'); 'sort' for sorting output by number of downloads |
figure |
(logical) decide of figure should be printed |
log |
(character) set count-axis of figure to linear or log-scale (by setting |
silent |
(logical) suppress messages |
callFrom |
(character) allow easier tracking of messages produced |
debug |
(logical) additional messages for debugging |
Detailed articles on this subject have been published on R-Hub (https://blog.r-hub.io/2020/05/11/packagerank-intro/) and on R-bloggers (https://www.r-bloggers.com/2020/10/a-cran-downloads-experiment/). The task of checking the number of downloads for a given package has also been addressed by several other packages (eg dlstats, cranlogs, adjustedcranlogs).
This function only allows accessing counts as listed on the website of www.datasciencemeta.com which get updated dayly.
Please note, that reading all lines from the website may take a few seconds !!
To get a better understanding of the counts read, reference quantiles for download-counts get added by default (see argument refQuant).
The (optional) figure can be drawn in linear scale (default, with minor zoom to lower number of counts) or in log (necessary for proper display of the entire range of counts), by setting the argument log="y".
The number of downloads counted by RStudio may not be a perfect measure for the actual usage/popularity of a given package, the articles cited above discuss this in more detail. For example, multiple downloads from the same IP or subsequent downloads of multiple (older) versions of the same package seem to get counted, too.
This function retuns a matrix with download counts (or NULL if the web-site can't be accessed or the query-packages are not found there)
packages cranlogs and packageRank
## Let's try a microscopic test-file (NOT representative for true up-to-date counts !!) pack1 <- c("cif", "bcv", "FinCovRegularization", "wrMisc", "wrProteo") testFi <- file.path(system.file("extdata", package="wrMisc"), "rpackagesMicro.html") packageDownloadStat(pack1, countUrl=testFi, log="y", figure=FALSE) ## For real online counting simply use the argument countUrl in default setting## Let's try a microscopic test-file (NOT representative for true up-to-date counts !!) pack1 <- c("cif", "bcv", "FinCovRegularization", "wrMisc", "wrProteo") testFi <- file.path(system.file("extdata", package="wrMisc"), "rpackagesMicro.html") packageDownloadStat(pack1, countUrl=testFi, log="y", figure=FALSE) ## For real online counting simply use the argument countUrl in default setting
Numerous network query tools produce a listing of pairs of nodes (with one pair of nodes per line).
Using this function such a matrix (or data.frame) can be combined to this more comprehensive view as propensity-matrix.
pairsAsPropensMatr(mat, silent = FALSE, debug = FALSE, callFrom = NULL)pairsAsPropensMatr(mat, silent = FALSE, debug = FALSE, callFrom = NULL)
mat |
(matrix) main input, matrix of interaction partners with each line as a separate pair of nodes; the first two columns should contain identifiers of the nodes |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Note, this has been primarily developed for undirected interaction networks, the resulting propensity-matrix does not show any orientation any more. In a number of applications (eg in protein-protein interaction networks, PPI) the resulting matrix may be rather sparse.
This function returns matrix or data.frame
uses typically input from filterNetw
pairs3L <- matrix(LETTERS[c(1,3,3, 2,2,1)], ncol=2) # loop of 3 (netw13pr <- pairsAsPropensMatr(pairs3L)) # as prop matrpairs3L <- matrix(LETTERS[c(1,3,3, 2,2,1)], ncol=2) # loop of 3 (netw13pr <- pairsAsPropensMatr(pairs3L)) # as prop matr
partialDist calculates distance matrix like dist for 1- or 2-dim data, but only partially, ie only cases of small distances.
This function was made for treating very large data-sets where only very close distances to a given point need to be found,
it allows to overcome memory-problems with larger data (and faster execution with > 50 rows of 'dat').
partialDist( dat, groups, overLap = TRUE, method = "euclidean", silent = FALSE, debug = FALSE, callFrom = NULL )partialDist( dat, groups, overLap = TRUE, method = "euclidean", silent = FALSE, debug = FALSE, callFrom = NULL )
dat |
(matrix of numeric values) main input |
groups |
(factor) to split using |
overLap |
(logical) if TRUE make groups overlapping by 1 value (ie maintain some context-information) |
method |
'character' name of method passed to |
silent |
(logical) suppress messages |
debug |
(logical) display additional messages for debugging |
callFrom |
(character) allow easier tracking of message(s) produced |
This function returns a matrix with partial distances (not of class 'dist' object)
set.seed(2016); mat3 <- matrix(runif(300),nr=30) round(dist(mat3), 1) round(partialDist(mat3, gr=3), 1)set.seed(2016); mat3 <- matrix(runif(300),nr=30) round(dist(mat3), 1) round(partialDist(mat3, gr=3), 1)
partUnlist does partial unlist for treating list of lists : New (returned) list has one level less of hierarchy
(Highest level list will be appended). In case of conflicting (non-null) listnames a prefix will be added.
Behaviour different to unlist when unlisting list of matrixes.
partUnlist(lst, sep = "_", silent = FALSE, debug = FALSE, callFrom = NULL)partUnlist(lst, sep = "_", silent = FALSE, debug = FALSE, callFrom = NULL)
lst |
(list) main input, list to be partially unlisted |
sep |
(character, length=1) separator for names |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns a list with partially reduced nested structure
partUnlist(list(list(a=11:12,b=21:24), list(c=101:101,d=201:204))) li4 <- list(c=1:3, M2=matrix(1:4,ncol=2), L3=list(L1=11:12, M3=matrix(21:26,ncol=2))) partUnlist(li4) unlist(li4, rec=FALSE)partUnlist(list(list(a=11:12,b=21:24), list(c=101:101,d=201:204))) li4 <- list(c=1:3, M2=matrix(1:4,ncol=2), L3=list(L1=11:12, M3=matrix(21:26,ncol=2))) partUnlist(li4) unlist(li4, rec=FALSE)
This function is a variant of paste for convenient use of paste-collapse and separation of last element to paste (via 'lastCol').
This function was mode for more human like enumeriating in output and messages.
If multiple arguments are given without names they will all be concatenated, if they contain names lazy evaluation for names will be tried
(with preference to longest match to argument names).
Note that some special characters (like backslash) may need to be protetected when used with 'collapse' or 'quoteC'.
Returns character vector of length 1 (everything pasted together)
pasteC(..., collapse = ", ", lastCol = " and ", quoteC = "")pasteC(..., collapse = ", ", lastCol = " and ", quoteC = "")
... |
(character) main input to be collapsed |
collapse |
(character,length=1) element to use for collapsing |
lastCol |
(character) text to use before last item enumerated element |
quoteC |
character to use for citing with quotations (default "") |
This function returns a character vector of truncated versions of intpup txt
paste for basic paste
pasteC(1:4)pasteC(1:4)
This function produces a logical matrix to be used as filter for lines of 'dat' for sufficient presence of non-NA values (ie limit number of NAs per line).
Filter abundance/expression data for min number and/or ratio of non-NA values in at east 1 of multiple groups.
This type of procedure is common in proteomics and tanscriptomics, where a NA can many times be assocoaued with quantitation below detetction limit.
presenceFilt( dat, grp, useComparison = NULL, maxGrpMiss = 1, ratMaxNA = 0.8, minVal = NULL, sep = NULL, experSetup = NULL, silent = FALSE, debug = FALSE, callFrom = NULL )presenceFilt( dat, grp, useComparison = NULL, maxGrpMiss = 1, ratMaxNA = 0.8, minVal = NULL, sep = NULL, experSetup = NULL, silent = FALSE, debug = FALSE, callFrom = NULL )
dat |
matrix or data.frame (abundance or expression-values which may contain some |
grp |
factor of min 2 levels describing which column of 'dat' belongs to which group (levels 1 & 2 will be used) |
useComparison |
(character or matrix) optional argument allowing to specify which pairwise comparions sould be performed, default |
maxGrpMiss |
(numeric) at least 1 group has not more than this number of NAs (otherwise marke line as bad) |
ratMaxNA |
(numeric) at least 1 group below this content of |
minVal |
(default NULL or numeric), any value below will be treated like |
sep |
(character) in case |
experSetup |
(list) optional experimental setup |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns a logical matrix (with separate col for each pairwise combination of 'grp' levels) indicating if line of 'dat' acceptable based on NAs (and values minVal)
presenceGrpFilt, there are also other packages on CRAN and Bioconductor dedicated to filtering
mat <- matrix(rep(8,150), ncol=15, dimnames=list(NULL, paste0(rep(LETTERS[4:2],each=6),1:6)[c(1:5,7:16)])) mat[lower.tri(mat)] <- NA mat[,15] <- NA mat[c(2:3,9),14:15] <- NA mat[c(1,10),13:15] <- NA mat # default : at least 1 group with max 1 NA and one group below 80% NA presenceFilt(mat, substr(colnames(mat),1,1)) # custom 2 groups presenceFilt(mat, rep(1:2,c(9,6))) # D1- C4, C5 - B4 # one more example dat1 <- matrix(1:56, ncol=7) dat1[c(2:6,10,12,18,19,20,22,23,26:28,30,31,34,38,39,50,54)] <- NA grp3 <- letters[c(3,3,2,2,1,1,1)] colnames(dat1) <- correctToUnique(grp3, sep="") dat1 ## At least one group wo any NAs presenceFilt(dat1, grp3, maxGr=0) presenceFilt(dat1, gr=gl(2,4)[-1], maxGr=1, ratM=0.1) presenceFilt(dat1, gr=gl(2,4)[-1], maxGr=2, rat=0.5)mat <- matrix(rep(8,150), ncol=15, dimnames=list(NULL, paste0(rep(LETTERS[4:2],each=6),1:6)[c(1:5,7:16)])) mat[lower.tri(mat)] <- NA mat[,15] <- NA mat[c(2:3,9),14:15] <- NA mat[c(1,10),13:15] <- NA mat # default : at least 1 group with max 1 NA and one group below 80% NA presenceFilt(mat, substr(colnames(mat),1,1)) # custom 2 groups presenceFilt(mat, rep(1:2,c(9,6))) # D1- C4, C5 - B4 # one more example dat1 <- matrix(1:56, ncol=7) dat1[c(2:6,10,12,18,19,20,22,23,26:28,30,31,34,38,39,50,54)] <- NA grp3 <- letters[c(3,3,2,2,1,1,1)] colnames(dat1) <- correctToUnique(grp3, sep="") dat1 ## At least one group wo any NAs presenceFilt(dat1, grp3, maxGr=0) presenceFilt(dat1, gr=gl(2,4)[-1], maxGr=1, ratM=0.1) presenceFilt(dat1, gr=gl(2,4)[-1], maxGr=2, rat=0.5)
The aim of this function is to filter for each group of columns for sufficient data as non-NA.
presenceGrpFilt( dat, grp, presThr = 0.75, silent = FALSE, debug = FALSE, callFrom = NULL )presenceGrpFilt( dat, grp, presThr = 0.75, silent = FALSE, debug = FALSE, callFrom = NULL )
dat |
matrix or data.frame (abundance or expression-values which may contain some |
grp |
factor of min 2 levels describing which column of 'dat' belongs to which group (levels 1 & 2 will be used) |
presThr |
(numeric) min ratio of non- |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function allows to identify lines with an NA-content above the threshold presThr per group as defined by the levels of factor grp.
With different types of projects/questions different threshold presThr levels may be useful.
For example, if one would like to keep the degree of threshold presThrs per group rather low, one could use a value of 0.75 (ie >= 75
logical matrix (with on column for each level of grp)
presenceFilt, there are also other packages totaly dedicated to filtering on CRAN and Bioconductor
mat <- matrix(NA, nrow=11, ncol=6) mat[lower.tri(mat)] <- 1 mat <- cbind(mat, mat[,1:4]) colnames(mat) <- c(paste0("re",1:6), paste0("x",1:4)) mat[6:8,7:10] <- mat[1:3,7:10] # ref mat[9:11,1:6] <- mat[2:4,1:6] ## accept 1 NA out of 4, 2 NA out of 6 (ie certainly present) (filt0a <- presenceGrpFilt(mat, rep(1:2, c(6,4)), pres=0.66)) ## accept 2 NA out of 4, 2 NA out of 6 (ie min 50% present) (filt0b <- presenceGrpFilt(mat, rep(1:2, c(6,4)), pres=0.5)) ## accept 3 NA out of 4, 4 NA out of 6 (ie possibly present) (filt0c <- presenceGrpFilt(mat, rep(1:2, c(6,4)), pres=0.19))mat <- matrix(NA, nrow=11, ncol=6) mat[lower.tri(mat)] <- 1 mat <- cbind(mat, mat[,1:4]) colnames(mat) <- c(paste0("re",1:6), paste0("x",1:4)) mat[6:8,7:10] <- mat[1:3,7:10] # ref mat[9:11,1:6] <- mat[2:4,1:6] ## accept 1 NA out of 4, 2 NA out of 6 (ie certainly present) (filt0a <- presenceGrpFilt(mat, rep(1:2, c(6,4)), pres=0.66)) ## accept 2 NA out of 4, 2 NA out of 6 (ie min 50% present) (filt0b <- presenceGrpFilt(mat, rep(1:2, c(6,4)), pres=0.5)) ## accept 3 NA out of 4, 4 NA out of 6 (ie possibly present) (filt0c <- presenceGrpFilt(mat, rep(1:2, c(6,4)), pres=0.19))
Some characters do have a special meaning when used with regular expressions.
This concerns characters like a point, parinthesis, backslash etc.
Thus, when using grep or any related command, shuch special characters must get protected in order to get considered as they are.
protectSpecChar( x, prot = c(".", "\\", "|", "(", ")", "[", "{", "^", "$", "*", "+", "?"), silent = TRUE, debug = FALSE, callFrom = NULL )protectSpecChar( x, prot = c(".", "\\", "|", "(", ")", "[", "{", "^", "$", "*", "+", "?"), silent = TRUE, debug = FALSE, callFrom = NULL )
x |
character vector to be prepared for use in regular expressions |
prot |
(character) collection of characters that need to be protected |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns a modified character vector
aa <- c("abc","abcde","ab.c","ab.c.e","ab*c","ab\\d") grepl("b.", aa) # all TRUE grepl("b\\.", aa) # manual prootection grepl(protectSpecChar("b."), aa)aa <- c("abc","abcde","ab.c","ab.c.e","ab*c","ab\\d") grepl("b.", aa) # all TRUE grepl("b\\.", aa) # manual prootection grepl(protectSpecChar("b."), aa)
This function takes a numeric vector of p-values and returns a vector of lfdr-values (local false discovery) using the package fdrtool. Multiple testing correction should be performed with caution, short series of p-values typically pose problems for transforming to lfdr. The transformation to lfdr values may give warning messages, in this case the resultant lfdr values may be invalid !
pVal2lfdr(x, silent = TRUE, debug = FALSE, callFrom = NULL)pVal2lfdr(x, silent = TRUE, debug = FALSE, callFrom = NULL)
x |
(numeric) vector of p.values |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns a (numeric) vector of lfdr values (or NULL if data insufficient to run the function 'fdrtool')
lfdr from fdrtool, other p-adjustments (multiple test correction, eg FDR) in p.adjust
## Note that this example is too small for estimating really meaningful fdr values ## In consequence, a warning will be issued. set.seed(2017); t8 <- matrix(round(rnorm(160,10,0.4),2), ncol=8, dimnames=list(letters[1:20], c("AA1","BB1","CC1","DD1","AA2","BB2","CC2","DD2"))) t8[3:6,1:2] <- t8[3:6,1:2]+3 # augment lines 3:6 (c-f) for AA1&BB1 t8[5:8,5:6] <- t8[5:8,5:6]+3 # augment lines 5:8 (e-h) for AA2&BB2 (c,d,g,h should be found) head(pVal2lfdr(apply(t8, 1, function(x) t.test(x[1:4], x[5:8])$p.value)))## Note that this example is too small for estimating really meaningful fdr values ## In consequence, a warning will be issued. set.seed(2017); t8 <- matrix(round(rnorm(160,10,0.4),2), ncol=8, dimnames=list(letters[1:20], c("AA1","BB1","CC1","DD1","AA2","BB2","CC2","DD2"))) t8[3:6,1:2] <- t8[3:6,1:2]+3 # augment lines 3:6 (c-f) for AA1&BB1 t8[5:8,5:6] <- t8[5:8,5:6]+3 # augment lines 5:8 (e-h) for AA2&BB2 (c,d,g,h should be found) head(pVal2lfdr(apply(t8, 1, function(x) t.test(x[1:4], x[5:8])$p.value)))
This function provides collecions of typical separators used for combined names in pair-wise testing for later choice of the most suited.
pwSeparatorList( type = "split1", silent = FALSE, debug = FALSE, callFrom = NULL )pwSeparatorList( type = "split1", silent = FALSE, debug = FALSE, callFrom = NULL )
type |
(character) allows selecting of different types of collections of separators |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Depending if one rather looks for separators for cutting existing names of for suggesting separators for fresh concatenation, two differentsets of collections are available via the argument type.
Using type="split" will default to type="split1", similarly type="combine" will be used as type="combine1".
The option type="split1" has a default collection of shorter/compact separators for splitting
The option type="split2" allows more extensive search for 38 separators (ie combinations with ' ','-' and '_'), but extensive checking may cost CPU time.
The option type="split3" has a shorter collection of 12 basic commonly used separators.
The option type="split4" to type="split9" default to 'split1'
The option type="combine1" does not suggest '–' (neither '__') since if '-' may not be chosen ins the first place, using '–' as separator next to '-' occuring inside gourp-names may not enhance visibility.
The option type="combine2" contains a collection of sperators using 'vs' or 'versus'
The option type="combine3" is designed for explicite terms (starts with ' - versus - ', for suggesting compact terms rather use type="combine1"
The option type="combine4" to type="combine9" default to 'combine1'
This function returns a charcter vector with proposed separators for later choosing the most suited
(for running multiple pair-wise test) moderTestXgrp, convPairwiseSetup, presenceFilt, getPWseparator, indexGroupsFromPW,
(used underneith:) grep, strsplit
pwSeparatorList(type="split1")pwSeparatorList(type="split1")
randIndFx calculates distance of categorical data (as Rand Index, Adjusted Rand Index or Jaccard Index).
Note: uses/requires package flexclust
Methods so far available (via flexclust): "ARI" .. adjusted Rand Index, "RI" .. Rand index, "J" .. Jaccard, "FM" .. Fowlkes-Mallows.
randIndFx( ma, method = "ARI", adjSense = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )randIndFx( ma, method = "ARI", adjSense = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )
ma |
(matrix) main input for distance calulation |
method |
(character) name of distance method (eg "ARI","RI","J","FM") |
adjSense |
(logical) allows introducing correlation/anticorrelation (interprete neg distance results as anti) |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns a distance matrix
comPart in randIndex
set.seed(2016); tab2 <- matrix(sample(1:2, size=42, replace=TRUE), ncol=7) if(requireNamespace("flexclust")) { flexclust::comPart(tab2[1,], tab2[2,]) flexclust::comPart(tab2[1,], tab2[3,]) flexclust::comPart(tab2[1,], tab2[4,]) } ## via randIndFx(): randIndFx(tab2, adjSense=FALSE) cor(t(tab2)) randIndFx(tab2, adjSense=TRUE)set.seed(2016); tab2 <- matrix(sample(1:2, size=42, replace=TRUE), ncol=7) if(requireNamespace("flexclust")) { flexclust::comPart(tab2[1,], tab2[2,]) flexclust::comPart(tab2[1,], tab2[3,]) flexclust::comPart(tab2[1,], tab2[4,]) } ## via randIndFx(): randIndFx(tab2, adjSense=FALSE) cor(t(tab2)) randIndFx(tab2, adjSense=TRUE)
Count the number of instances where the corresponding columns of 'dat' have a value matching the group number as specified by 'grp'.
Counting will be performed/repeated independently for each line of 'dat'.
Returns array (1st dim is rows of dat, 2nd is unique(grp), 3rd dim is ok/bad), these results may be tested using eg fisher.test.
This function was made for prearing to test the ranking of multiple features (lines in 'mat') including replicates (levels of 'grp').
rankToContigTab(dat, grp)rankToContigTab(dat, grp)
dat |
(matrix or data.frame of integer values) ranking of multiple features (lines), equal ranks may occur |
grp |
(integer) expected ranking |
array (1st dim is rows of dat, 2nd is unique(grp), 3rd dim is ok/bad)
# Let's create a matrix with ranks (equal ranks do occur) ma0 <- matrix(rep(1:3,each=6), ncol=6, dimnames=list( c("li1","li2","ref"), letters[1:6])) ma0[1,6] <- 1 # create item not matching correctly ma0[2,] <- c(3:1,2,1,3) # create items not matching correctly gr0 <- gl(3,2) # the expected ranking (as duplicates) (count0 <- rankToContigTab(ma0,gr0)) cTab <- t(apply(count0, c(1,3) ,sum)) # Now we can compare the ranking of line1 to ref ... fisher.test(cTab[,c(3,1)]) # test li1 against ref fisher.test(cTab[,c(3,2)]) # test li2 against ref# Let's create a matrix with ranks (equal ranks do occur) ma0 <- matrix(rep(1:3,each=6), ncol=6, dimnames=list( c("li1","li2","ref"), letters[1:6])) ma0[1,6] <- 1 # create item not matching correctly ma0[2,] <- c(3:1,2,1,3) # create items not matching correctly gr0 <- gl(3,2) # the expected ranking (as duplicates) (count0 <- rankToContigTab(ma0,gr0)) cTab <- t(apply(count0, c(1,3) ,sum)) # Now we can compare the ranking of line1 to ref ... fisher.test(cTab[,c(3,1)]) # test li1 against ref fisher.test(cTab[,c(3,2)]) # test li2 against ref
This function calculates all possible pairwise ratios between all individual calues of x and y, or samples up to a maximum number of combinations.
ratioAllComb( x, y, maxLim = 10000, isLog = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )ratioAllComb( x, y, maxLim = 10000, isLog = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )
x |
(numeric) vector, numerator for constructing rations |
y |
(numeric) vector, denominator for constructing rations |
maxLim |
(integer) allows reducing complexity by drawing for very long x or y |
isLog |
(logical) adjust ratio calculation to log-data |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
set.seed(2014); ra1 <- c(rnorm(9,2,1),runif(8,1,2)) ratioAllComb(ra1[1:9],ra1[10:17]) boxplot(list(norm=ra1[1:9], unif=ra1[10:17], rat=ratioAllComb(ra1[1:9],ra1[10:17])))set.seed(2014); ra1 <- c(rnorm(9,2,1),runif(8,1,2)) ratioAllComb(ra1[1:9],ra1[10:17]) boxplot(list(norm=ra1[1:9], unif=ra1[10:17], rat=ratioAllComb(ra1[1:9],ra1[10:17])))
This function transforms ratio 'x' to ppm (parts per million). If 'y' not given (or different length as 'x'), then 'x' is assumed as ratio otherise rations are constructed as x/y is used lateron. Does additional checking : negative values not expected - will be made absolute !
ratioToPpm( x, y = NULL, nSign = NULL, silent = FALSE, debug = FALSE, callFrom = NULL )ratioToPpm( x, y = NULL, nSign = NULL, silent = FALSE, debug = FALSE, callFrom = NULL )
x |
(numeric) main input |
y |
(numeric) optional value to construct ratios (x/y). If NULL (or different length as 'x'), then 'x' will be considered as ratio. |
nSign |
(numeric) number of significan digits |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns a numeric vector of ppm values
XYToDiffPpm for ppm of difference as used in mass spectrometrie
set.seed(2017); aa <- c(1.000001,0.999999,1+rnorm(10,0,0.001)) cbind(x=aa,ppm=ratioToPpm(aa,nSign=4))set.seed(2017); aa <- c(1.000001,0.999999,1+rnorm(10,0,0.001)) cbind(x=aa,ppm=ratioToPpm(aa,nSign=4))
This function was designed to read screening data split in parts (with common structure) and saved to multiple files,
to extract the numeric columns and to compile all (numeric) data to a single array (or list). Some screening platforms save results while progressing
through a pile of microtiter-plates separately. The organization of the resultant files is structured through file-names and all files have exactely the same organization of lines and columns/
European or US-formatted csv files can be read, if argument fileFormat is NULL both types will be tested, otherwise it allows to specify a given format.
The presence of headers (to be used as column-names) may be tested using checkFormat.
readCsvBatch( fileNames = NULL, path = ".", fileFormat = "Eur", checkFormat = TRUE, returnArray = TRUE, columns = c("Plate", "Well", "StainA"), excludeFiles = "All infected plates", simpleNames = TRUE, minNamesLe = 4, silent = FALSE, debug = FALSE, callFrom = NULL )readCsvBatch( fileNames = NULL, path = ".", fileFormat = "Eur", checkFormat = TRUE, returnArray = TRUE, columns = c("Plate", "Well", "StainA"), excludeFiles = "All infected plates", simpleNames = TRUE, minNamesLe = 4, silent = FALSE, debug = FALSE, callFrom = NULL )
fileNames |
(character) names of files to be read, if |
path |
(character) where files should be read (folders should be written in R-style) |
fileFormat |
(character) may be |
checkFormat |
(logical) if |
returnArray |
(logical) allows switching from array to list-output |
columns |
(NULL or character) column-headers to be extracted (if specified), 2nd value may be comlumn with rownames (if rownames are encountered as increasing rownames) |
excludeFiles |
(character) names of files to exclude (only used when reading all files of given directory) |
simpleNames |
(logical) allows truncating names (from beginning) to get to variable part (using .trimLeft()), but keeping 'minNamesLe' |
minNamesLe |
(interger) min length of column-names if simpleNames=TRUE |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
This function returns an array (or list if returnArray=FALSE) of all numeric data read (numerical columns only) from individual files
read.table, writeCsv, readXlsxBatch
path1 <- system.file("extdata", package="wrMisc") fiNa <- c("pl01_1.csv","pl01_2.csv","pl02_1.csv","pl02_2.csv") datAll <- readCsvBatch(fiNa, path1) str(datAll) ## batch reading of all csv files in specified path : datAll2 <- readCsvBatch(fileNames=NULL, path=path1, silent=TRUE)path1 <- system.file("extdata", package="wrMisc") fiNa <- c("pl01_1.csv","pl01_2.csv","pl02_1.csv","pl02_2.csv") datAll <- readCsvBatch(fiNa, path1) str(datAll) ## batch reading of all csv files in specified path : datAll2 <- readCsvBatch(fileNames=NULL, path=path1, silent=TRUE)
This function allows batch reading of multiple tabulated text files n batch.
The files can be designed specifically, or, alternatively all files from a given directory can be read.
If package data.table is available, faster reading of files will be performed using the function fread.
readTabulatedBatch( query, path = NULL, dec = ".", header = "auto", strip.white = FALSE, blank.lines.skip = TRUE, fill = FALSE, filtCol = 2, filterAsInf = TRUE, filtVal = 5000, silent = FALSE, callFrom = NULL, debug = FALSE )readTabulatedBatch( query, path = NULL, dec = ".", header = "auto", strip.white = FALSE, blank.lines.skip = TRUE, fill = FALSE, filtCol = 2, filterAsInf = TRUE, filtVal = 5000, silent = FALSE, callFrom = NULL, debug = FALSE )
query |
(character) vector of file-names to be read, if |
path |
(character) path for reading files, if |
dec |
(character, length=1) decimals to use, will be passed to |
header |
(character, length=1) path for reading files, if |
strip.white |
(logical, length=1) Strips leading and trailing whitespaces of unquoted fields, will be passed to |
blank.lines.skip |
(logical, length=1) If |
fill |
(logical, length=1) If |
filtCol |
(integer, length=1) which columns should be used for filtering, if |
filterAsInf |
(logical, length=1) filter as inferior or equal ( |
filtVal |
(numeric, length=1) which numeric threshold should be used for filtering, if |
silent |
(logical) suppress messages |
callFrom |
(character) allow easier tracking of messages produced |
debug |
(logical) display additional messages for debugging |
If you want to provide a flexible pattern of ffile-names, this has to be done before calling this usntion, eg using grep to provide an explicit collection of flles.
However, it is possible to read different files from different locations/directories, the length of path must match the length of query
This function returns a list of data.frames
fread, read.delim, for reading batch of csv files : readCsvBatch
path1 <- system.file("extdata", package="wrMisc") fiNa <- c("a1.txt","a2.txt") allTxt <- readTabulatedBatch(fiNa, path1) str(allTxt)path1 <- system.file("extdata", package="wrMisc") fiNa <- c("a1.txt","a2.txt") allTxt <- readTabulatedBatch(fiNa, path1) str(allTxt)
Reading the content of files where the number of separators (eg tabulation) is variable poses problems with traditional methods for reding files, like read.table.
This function reads each line independently and then parses all separators therein. The first line is assumed to be column-headers.
Finally, all data will be returned in a matrix adopted to the line with most separators and if the number of column-headers is insufficient, new (unique) column-headers will be generated.
Thus, the lines may contain different number of elements, empty elements (ie tabular fields) will always get added to right of data read
and their content will be as defined by argument emptyFields (default NA).
readVarColumns( fiName, path = NULL, sep = "\t", header = TRUE, emptyFields = NA, refCo = NULL, supNa = NULL, silent = FALSE, debug = FALSE, callFrom = NULL )readVarColumns( fiName, path = NULL, sep = "\t", header = TRUE, emptyFields = NA, refCo = NULL, supNa = NULL, silent = FALSE, debug = FALSE, callFrom = NULL )
fiName |
(character) file-name |
path |
(character) optional path |
sep |
(character) separator (between columns) |
header |
(logical) indicating whether the file contains the names of the variables as its first line. |
emptyFields |
( |
refCo |
(integer) for custom choice of column to be used as row-names (default will use 1st text-column) |
supNa |
(character) base for constructing name for columns wo names (+counter starting at 2), default column-name to left of 1st col wo colname |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
Note, this functions assumes one line of header and at least one line of data ! Note, for numeric data the comma is assumed to be US-Style (as '.'). Note, that it is assumed, that any missing fields for the complete tabular view are missing on the right (ie at the end of line) !
This function returns a matrix (character or numeric)
for regular 'complete' data read.table and its argument flush
path1 <- system.file("extdata", package="wrMisc") fiNa <- "Names1.tsv" datAll <- readVarColumns(fiName=file.path(path1, fiNa)) str(datAll)path1 <- system.file("extdata", package="wrMisc") fiNa <- "Names1.tsv" datAll <- readVarColumns(fiName=file.path(path1, fiNa)) str(datAll)
readXlsxBatch reads data out of multiple xlsx files, the sheet indicated by 'sheetInd' will be considered.
All files must have the same organization of data, as this is typically the case when high-throughput measurements are automatically saved while experiments progress.
In particular, the first file read is used to structure the output.
readXlsxBatch( fileNames = NULL, path = ".", fileExtension = "xlsx", excludeFiles = NULL, sheetInd = 1, checkFormat = TRUE, returnArray = TRUE, columns = c("Plate", "Well", "StainA"), simpleNames = 3, silent = FALSE, debug = FALSE, callFrom = NULL )readXlsxBatch( fileNames = NULL, path = ".", fileExtension = "xlsx", excludeFiles = NULL, sheetInd = 1, checkFormat = TRUE, returnArray = TRUE, columns = c("Plate", "Well", "StainA"), simpleNames = 3, silent = FALSE, debug = FALSE, callFrom = NULL )
fileNames |
(character) provide either explicit list of file-names to be read or leave |
path |
(character) there may be a different path for each file |
fileExtension |
(character) extension of files (default=' |
excludeFiles |
(character) names of files to exclude (only used when reading all files of given directory) |
sheetInd |
(character or integer) specify which sheet to extract (as exact name of sheed or sheet-number, eg |
checkFormat |
(logical) if |
returnArray |
(logical) allows switching from array to list-output |
columns |
(NULL or character) column-headers to be extracted (if specified, otherwise all columns will be extracted) |
simpleNames |
(integer), if |
silent |
(logical) suppress messages |
debug |
(logical) display additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
By default all columns with text-content may be eliminated to keep the numeric part only, which may then get organized to a 3-dim numeric array (where the additional files will be used as 2nd dimension and multiple columns per file shown as 3rd dimension).
NOTE : (starting from version wrMisc-1.5.5) requires packages readxl and
Rcpp being installed !
(This allows much faster and memory efficient processing than previous use of package 'xlsx')
This function returns a list of data.frames
read_excel; for simple reading of (older) xls-files under 32-bit R one may also see the package RODBC
path1 <- system.file("extdata", package="wrMisc") fiNa <- c("pl01_1.xlsx","pl01_2.xlsx","pl02_1.xlsx","pl02_2.xlsx") datAll <- readXlsxBatch(fiNa, path1) str(datAll) ## Now let's read all xlsx files of directory datAll2 <- readXlsxBatch(path=path1, silent=TRUE) identical(datAll, datAll2)path1 <- system.file("extdata", package="wrMisc") fiNa <- c("pl01_1.xlsx","pl01_2.xlsx","pl02_1.xlsx","pl02_2.xlsx") datAll <- readXlsxBatch(fiNa, path1) str(datAll) ## Now let's read all xlsx files of directory datAll2 <- readXlsxBatch(path=path1, silent=TRUE) identical(datAll, datAll2)
reduceTable treats/reduces results from table to 'nGrp' groups,
optional indiv resolution of 'separFirst' (numeric or NULL).
Mainly made for reducing the number of classes for betters plots with pie
reduceTable(tab, separFirst = 4, nGrp = 15)reduceTable(tab, separFirst = 4, nGrp = 15)
tab |
output of |
separFirst |
(integer or NULL) optinal separartion of n 'separFirst' groups (value <2 or NULL will priviledge more uniform size of groups, higher values will cause small inital and larger tailing groups) |
nGrp |
(integer) number of groups expected |
This function returns a numeric vector with number of counts and class-borders as names (like table).
set.seed(2018); dat <- sample(11:60,200,repl=TRUE) pie(table(dat)) pie(reduceTable(table(dat), sep=NULL)) pie(reduceTable(table(dat), sep=NULL), init.angle=90, clockwise=TRUE, col=rainbow(20)[1:15], cex=0.8)set.seed(2018); dat <- sample(11:60,200,repl=TRUE) pie(table(dat)) pie(reduceTable(table(dat), sep=NULL)) pie(reduceTable(table(dat), sep=NULL), init.angle=90, clockwise=TRUE, col=rainbow(20)[1:15], cex=0.8)
This function does rescaling: linear transform simple vector 'inDat' that (mean of) elements of names cited in 'refLst' will end up as values 'regrTo'. Regress single vector according to 'refLst' (describing names of inDat). If 'refLst' contains 2 groups, the 1st group will be set to the 1st value of 'regrTo' (and the 2nd group of 'refLst' to the 2nd 'regtTo')
regrBy1or2point( inDat, refLst, regrTo = c(1, 0.5), silent = FALSE, debug = FALSE, callFrom = NULL )regrBy1or2point( inDat, refLst, regrTo = c(1, 0.5), silent = FALSE, debug = FALSE, callFrom = NULL )
inDat |
(matrix or data.frame) data to rescaled |
refLst |
list of names existing in inDat (one group of names for each value in 'regrTo'), to be transformed in values precised in 'regTo'; if no matches to names of 'inDat' found, the 2 lowest and/or highest highest values will be chosen |
regrTo |
(numeric,length=2) range (at scale 0-1) of target-values for mean of elements cited in 'refLst' |
silent |
(logical) suppress messages if |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
This function returns a normalized matrix
adjBy2ptReg, regrMultBy1or2point
set.seed(2016); dat1 <- 1:50 +(1:50)*round(runif(50),1) names(dat1) <- 1:length(dat1) reg1 <- regrBy1or2point(dat1, refLst=c("2","49")) plot(reg1, dat1)set.seed(2016); dat1 <- 1:50 +(1:50)*round(runif(50),1) names(dat1) <- 1:length(dat1) reg1 <- regrBy1or2point(dat1, refLst=c("2","49")) plot(reg1, dat1)
This function regresses each col of matrix according to 'refLst'(describing rownames of inDat). If 'refLst' conatins 2 groups, the 1st group will be set to the 1st value of 'regrTo' (and the 2nd group of 'refLst' to the 2nd 'regtTo')
regrMultBy1or2point( inDat, refLst, regrTo = c(1, 0.5), silent = FALSE, debug = FALSE, callFrom = NULL )regrMultBy1or2point( inDat, refLst, regrTo = c(1, 0.5), silent = FALSE, debug = FALSE, callFrom = NULL )
inDat |
(matrix or data.frame) data to be rescaled |
refLst |
list of names existing in inDat (one group of names for each value in 'regrTo'), to be transformed in values precised in 'regTo'; if no matches to names of 'inDat' found, the 2 lowest and/or highest highest values will be chosen |
regrTo |
(numeric,length=2) range (at scale 0-1) of target-values for mean of elements cited in 'refLst' |
silent |
(logical) suppress messages if |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
This function returns a normalized matrix
set.seed(2016); dat2 <- round(cbind(1:50 +(1:50)*runif(50),2.2*(1:50) +rnorm(50,0,3)),1) rownames(dat2) <- 1:nrow(dat2) reg1 <- regrBy1or2point(dat2[,1],refLst=list(as.character(5:7),as.character(44:45))) reg2 <- regrMultBy1or2point(dat2,refLst=list(as.character(5:7),as.character(44:45))) plot(dat2[,1],reg2[,1]) identical(reg1,reg2[,1]) identical(dat2[,1],reg2[,1])set.seed(2016); dat2 <- round(cbind(1:50 +(1:50)*runif(50),2.2*(1:50) +rnorm(50,0,3)),1) rownames(dat2) <- 1:nrow(dat2) reg1 <- regrBy1or2point(dat2[,1],refLst=list(as.character(5:7),as.character(44:45))) reg2 <- regrMultBy1or2point(dat2,refLst=list(as.character(5:7),as.character(44:45))) plot(dat2[,1],reg2[,1]) identical(reg1,reg2[,1]) identical(dat2[,1],reg2[,1])
This function renames columns of 'refMatr' using 2-column matrix (or data.frame) indicating old and new names (for replacement).
renameColumns(refMatr, newName, silent = FALSE, debug = FALSE, callFrom = NULL)renameColumns(refMatr, newName, silent = FALSE, debug = FALSE, callFrom = NULL)
refMatr |
matrix (or data.frame) where column-names should be changed |
newName |
(matrix of character) giving correspondence of old to new names (number of lines must match number of columns of 'refMatr') |
silent |
(logical) suppres messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
This function returns a matrix (or data.frame) with renamed columns
ma <- matrix(1:8,ncol=4,dimnames=list(1:2,LETTERS[1:4])) replBy1 <- cbind(new=c("dd","bb","z_"),old=c("D","B","zz")) replBy2 <- matrix(c("D","B","zz","dd","bb","z_"),ncol=2) replBy3 <- matrix(c("X","Y","zz","xx","yy","z_"),ncol=2) renameColumns(ma,replBy1) renameColumns(ma,replBy2) renameColumns(ma,replBy3)ma <- matrix(1:8,ncol=4,dimnames=list(1:2,LETTERS[1:4])) replBy1 <- cbind(new=c("dd","bb","z_"),old=c("D","B","zz")) replBy2 <- matrix(c("D","B","zz","dd","bb","z_"),ncol=2) replBy3 <- matrix(c("X","Y","zz","xx","yy","z_"),ncol=2) renameColumns(ma,replBy1) renameColumns(ma,replBy2) renameColumns(ma,replBy3)
Reorganize input matrix as sorted by cluster numbers (and geometric mean) according to vector with cluster names, and index for sorting per cluster and per geometric mean.
In case mat is an array, the 3rd dimension will be considered as 'column' with arguments useColumn ( and cluNo, if it designs a 'column' of mat).
reorgByCluNo( mat, cluNo, useColumn = NULL, meanCol = NULL, addInfo = TRUE, retList = FALSE, silent = FALSE, callFrom = NULL, debug = FALSE )reorgByCluNo( mat, cluNo, useColumn = NULL, meanCol = NULL, addInfo = TRUE, retList = FALSE, silent = FALSE, callFrom = NULL, debug = FALSE )
mat |
(matrix or data.frame) main input |
cluNo |
(positive integer, length to match nrow(dat) initial cluster numbers for each line of 'mat' (obtained by separate clustering or other segmentation) or may desinn column of |
useColumn |
(character or integer) the columns to use from |
meanCol |
(character or integer) alternative summarizing data for intra-cluster sorting (instead of geometric mean) |
addInfo |
(logical) allows of columns 'index', 'geoMean' and 'cluNo' (or array if |
retList |
(logical) return as list of matrixes (or array if |
silent |
(logical) suppress messages |
callFrom |
(character) allow easier tracking of messages produced |
debug |
(logical) additional messages for debugging |
This function returns a list or array (as 2- or 3 dim) with possible number of occurances for each of the 3 elements in nMax. Read results vertical : out[[1]] or out[,,1] .. (multiplicative) table for 1st element of nMax; out[,,2] .. for 2nd
pairwise combinations combn, clustering kmeans
dat1 <- matrix(round(runif(24),2), ncol=3, dimnames=list(NULL,letters[1:3])) clu <- stats::kmeans(dat1, 5)$cluster reorgByCluNo(dat1, clu) dat2 <- cbind(dat1, clu=clu) reorgByCluNo(dat2, "clu")dat1 <- matrix(round(runif(24),2), ncol=3, dimnames=list(NULL,letters[1:3])) clu <- stats::kmeans(dat1, 5)$cluster reorgByCluNo(dat1, clu) dat2 <- cbind(dat1, clu=clu) reorgByCluNo(dat2, "clu")
Replace Separator In Vector Of Pairwise Group-Names
This function allows identifying and substituting a separator used in a character vector concatenated of pairwise groups.
replacePWseparator( compNames, newSep, potSep = c("-", "---", "_", "___", ".", "-vs-", "_vs_", "--vs--", "__vs__", " ", " "), silent = FALSE, debug = FALSE, callFrom = NULL )replacePWseparator( compNames, newSep, potSep = c("-", "---", "_", "___", ".", "-vs-", "_vs_", "--vs--", "__vs__", " ", " "), silent = FALSE, debug = FALSE, callFrom = NULL )
compNames |
(character or integer) names of pairwise combined group-names |
newSep |
(character of length=1) new separator between group-names for pair of names; if |
potSep |
(character) potential separators to be checked if occuring in |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns a character vector with group-wise substituted separators (or NULL if conflicts appear)
indexGroupsFromPW, getPWseparator, .getPWseparator
replacePWseparator(compNames=c("B-C","B-D","C-D"), newSep="-vs-")replacePWseparator(compNames=c("B-C","B-D","C-D"), newSep="-vs-")
This function was designed for mining annotation information organized in multiple columns to identify the (potential) grouping of multiple samples, ie to determine factor levels.
The argument method allows further finetuning if high or low number of groups should be preferred, if multiple columns may be combined, or to choose a particular custom column for desiganting factor levels.
replicateStructure( x, method = "median", sep = "__", exclNoRepl = TRUE, trimNames = FALSE, includeOther = FALSE, silent = FALSE, callFrom = NULL, debug = FALSE )replicateStructure( x, method = "median", sep = "__", exclNoRepl = TRUE, trimNames = FALSE, includeOther = FALSE, silent = FALSE, callFrom = NULL, debug = FALSE )
x |
(matrix or data.frame) the annotation to inspect; each column is supposed to describe another set of annoation/metadata for the rows of |
method |
(character, length=1) the procedure to choose column(s) with properties of information, may be |
sep |
(character) separator used when a method combining multiple columns (eg combAll, combNonOrth) is chosen (should not appear anywhere in |
exclNoRepl |
(logical) decide whether columns with all values different (ie no replicates or max divergency) should be excluded |
trimNames |
(logical) optional trimming of names in |
includeOther |
(logical) include $allCols with pattern of (all) other columns |
silent |
(logical) suppress messages |
callFrom |
(character) allow easier tracking of messages produced |
debug |
(logical) additional messages for debugging |
Statistical tests require specifying which samples should be considered as replicates of whom. In some cases, like the Sdrf-format, automatic mining of such annotation to indentify an experiment's underlying structure of replicates may be challanging, since the key information may not always be found in the same column. For this reason this function allows inspecting all columns of a matrix of data.frame to identify which colmns may serve describing groups of replicates.
The argument exclNoRepl=TRUE allows excluding all columns with different content for each line (like line-numbers), ie information without any replicates.
It is set by default to TRUE to exclude such columns, since statistical tests usually do require some replicates.
When using as method="combAll", there is risk all lines (samples) will be be considered different and no replicates remain.
To avoid this situation the argument can be set to method="combNonOrth".
Using this mode it will be checked if more columns will lead to complete loss of replicates, and -if so- concerned columns omitted.
This function returns a list with $col (column index relativ to x), $lev (abstract labels of level),
$meth (note of method finally used) and $allCols with general replicate structure of all columns of x
duplicated, uses trimRedundText; for chosing single most likely column describing sample-names and groups of replicates chooseGroupNames
## a is all different, b is groups of 2, ## c & d are groups of 2 nut NOT 'same general' pattern as b strX <- data.frame(a=letters[18:11], b=letters[rep(c(3:1,4), each=2)], c=letters[rep(c(5,8:6), each=2)], d=letters[c(1:2,1:3,3:4,4)], e=letters[rep(c(4,8,4,7),each=2)], f=rep("z",8) ) strX replicateStructure(strX[,1:2]) replicateStructure(strX[,1:4], method="combAll") replicateStructure(strX[,1:4], method="combAll", exclNoRepl=FALSE) replicateStructure(strX[,1:4], method="combNonOrth", exclNoRepl=TRUE) replicateStructure(strX, method="lowest") replicateStructure(strX, method=3, includeOther=TRUE) # custom choice of 3rd column## a is all different, b is groups of 2, ## c & d are groups of 2 nut NOT 'same general' pattern as b strX <- data.frame(a=letters[18:11], b=letters[rep(c(3:1,4), each=2)], c=letters[rep(c(5,8:6), each=2)], d=letters[c(1:2,1:3,3:4,4)], e=letters[rep(c(4,8,4,7),each=2)], f=rep("z",8) ) strX replicateStructure(strX[,1:2]) replicateStructure(strX[,1:4], method="combAll") replicateStructure(strX[,1:4], method="combAll", exclNoRepl=FALSE) replicateStructure(strX[,1:4], method="combNonOrth", exclNoRepl=TRUE) replicateStructure(strX, method="lowest") replicateStructure(strX, method=3, includeOther=TRUE) # custom choice of 3rd column
With several screening techniques used in hight-throughput biology values at/below detection limit are returned as NA.
However, the resultant NA-values may be difficult to analyse properly, simply ignoring NA-values mat not be a good choice.
When (technical) replicate measurements are available, one can look for cases where one gave an NA while the other did not
with the aim of investigating such 'NA-neighbours'.
replNAbyLow( x, grp, quant = 0.8, signific = 3, unif = TRUE, absOnly = FALSE, seed = NULL, silent = FALSE, debug = FALSE, callFrom = NULL )replNAbyLow( x, grp, quant = 0.8, signific = 3, unif = TRUE, absOnly = FALSE, seed = NULL, silent = FALSE, debug = FALSE, callFrom = NULL )
x |
(numeric matrix or data.frame) main input |
grp |
(factor) to organize replicate columns of (x) |
quant |
(numeric) quantile form 'neighbour' values to use as upper limit for random values |
signific |
number of signif digits for random values |
unif |
(logical) toggle between uniform and Gaussian random values |
absOnly |
(logical) if TRUE, make negative NA-replacment values positive as absolute values |
seed |
(integer) for use with set.seed for reproducible output |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
replNAbyLow locates and replaces NA values by (random) values from same line & same group 'grp'.
The origin of NAs should be predominantly absence of measure (quantitation) due to signal below limit of detection
and not saturation at upper detection limit or other technical problems.
Note, this approach may be not optimal if the number of NA-neighbours is very low.
Replacamet is done -depending on agrument 'unif'- by Gaussian random model based on neighbour values (within same group),
using their means and sd, or a uniform random model (min and max of neighbour values) .
Then numeric matrix (same dim as 'x') with NA replaced is returned.
This function retuirns a numeric matrix (same dim as 'x') with NA replaced
dat <- matrix(round(rnorm(30),2),ncol=6) grD <- gl(2,3) dat[sort(sample(1:30,9,repl=FALSE))] <- NA dat; replNAbyLow(dat,gr=grD)dat <- matrix(round(rnorm(30),2),ncol=6) grD <- gl(2,3) dat[sort(sample(1:30,9,repl=FALSE))] <- NA dat; replNAbyLow(dat,gr=grD)
This function calculates CVs of replicates from list of 2 or 3-dim arrays (where 2nd dim is replicates, 3rd dim may be channel). Note : all list-elements of must MUST have SAME dimensions ! When treating data from microtiter plates (eg 8x12) data are typically spread over multiple plates, ie initial matrixes that are the organized into arrays. Returns matrix or array (1st dim is intraplate-position, 2nd .. plate-group/type, 3rd .. channels)
replPlateCV(lst, silent = FALSE, debug = FALSE, callFrom = NULL)replPlateCV(lst, silent = FALSE, debug = FALSE, callFrom = NULL)
lst |
list of matrixes : suppose lines are independent elements, colums are replicates of the 1st column. All matrixes must have same dimensions |
silent |
(logical) suppress messages if |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
This function returns a matrix or array (1st dim is intraplate-position, 2nd .. plate-group/type, 3rd .. channels)
set.seed(2016); ra1 <- matrix(rnorm(3*96),nrow=8) pla1 <- list(ra1[,1:12],ra1[,13:24],ra1[,25:36]) replPlateCV(pla1) arrL1 <- list(a=array(as.numeric(ra1)[1:192],dim=c(8,12,2)), b=array(as.numeric(ra1)[97:288],dim=c(8,12,2))) replPlateCV(arrL1)set.seed(2016); ra1 <- matrix(rnorm(3*96),nrow=8) pla1 <- list(ra1[,1:12],ra1[,13:24],ra1[,25:36]) replPlateCV(pla1) arrL1 <- list(a=array(as.numeric(ra1)[1:192],dim=c(8,12,2)), b=array(as.numeric(ra1)[97:288],dim=c(8,12,2))) replPlateCV(arrL1)
This function removes lines of matrix that are redundant /duplicated for 1st and 2nd column (irrespective of content of their columns). The first occurance of redundant /duplicated elements is kept.
rmDupl2colMatr( mat, useCol = c(1, 2), silent = FALSE, debug = FALSE, callFrom = NULL )rmDupl2colMatr( mat, useCol = c(1, 2), silent = FALSE, debug = FALSE, callFrom = NULL )
mat |
(matrix or data.frame) main input |
useCol |
(integer, length=2) columns to consider/use when looking for duplicated entries |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns a matrix where duplictaed lines are removed
mat <- matrix(1:12,ncol=3) mat[3,1:2] <- mat[1,1:2] rmDupl2colMatr(mat)mat <- matrix(1:12,ncol=3) mat[3,1:2] <- mat[1,1:2] rmDupl2colMatr(mat)
This function allows indentifying, removing or renaming enumerator tag/name (or remove entire enumerator) from tailing enumerators (eg 'abc_No1' to 'abc_1'). A panel of potential candidates as combination of separator-symbols and separtor text/words will be tested to find if one matches all data. In case the main input is a matrix, all columns will be tested independently to find the first column where one specific combination of separator-symbols and separtor text/words is found. Several options exist for the output, the combination of separator-symbols and separtor text/words may be included, too.
rmEnumeratorName( dat, nameEnum = c("Number", "No", "#", "Replicate", "Sample"), sepEnum = c(" ", "-", "_", "/"), newSep = "", incl = c("anyCase", "trim2"), silent = FALSE, debug = FALSE, callFrom = NULL )rmEnumeratorName( dat, nameEnum = c("Number", "No", "#", "Replicate", "Sample"), sepEnum = c(" ", "-", "_", "/"), newSep = "", incl = c("anyCase", "trim2"), silent = FALSE, debug = FALSE, callFrom = NULL )
dat |
(character vecor or matrix) main input |
nameEnum |
(character) potential enumerator-names |
sepEnum |
(character) potential separators for enumerator-names |
newSep |
(character) potential enumerator-names |
incl |
(character) options to include further variants of the enumerator-names,
use |
silent |
(logical) suppress messages |
debug |
(logical) display additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
In case only digit-enumerators are present (ie, without repetitive text), one has to use incl="rmEnum" to remove terminal enumerators.
This will work, only when all items do contain terminal digits.
Please note, that checking a variety of different separator text-word and separator-symbols may give an important number of combinations to check.
In particular, when automatic trimming of separator text-words is added (eg incl="trim2"), the complexity of associated searches increases quickly.
Thus, with large data-sets restricting the content of the arguments nameEnum, sepEnum and (in particular) newSep to the most probable terms/options
is suggested to help reducing demands on memory and CPU.
In case the input dat is a matrix and multiple different numerator-types are found, only the first colum (from the left) will be treated.
If you which to remove/subsitute mutiple types of enumerators the function rmEnumeratorName must be run independently, see last example below.
This function returns a corrected vector (or matrix), or a list if incl="rmEnumL" containing $dat (corrected data),
$pattern (the combination of separator-symbols and separtor text/words found), and if input is matrix $column (which column of the input was identified and treated)
when the exact pattern is known grep and sub may allow direct manipulations much faster
xv <- c("hg_1","hjRe2_2","hk-33") rmEnumeratorName(xv) rmEnumeratorName(xv, incl="rmEnum") xx <- c("hg_Re1","hjRe2_Re2","hk-Re3_Re33") rmEnumeratorName(xx) rmEnumeratorName(xx, newSep="--") rmEnumeratorName(xx, incl="anyCase") xy <- cbind(a=11:13, b=c("11#11","2_No2","333_samp333"), c=xx) rmEnumeratorName(xy) rmEnumeratorName(xy,incl=c("anyCase","trim2","rmEnumL")) xz <- cbind(a=11:13, b=c("23#11","4#2","567#333"), c=xx) apply(xz, 2, rmEnumeratorName, sepEnum=c("","_"), newSep="_", silent=TRUE)xv <- c("hg_1","hjRe2_2","hk-33") rmEnumeratorName(xv) rmEnumeratorName(xv, incl="rmEnum") xx <- c("hg_Re1","hjRe2_Re2","hk-Re3_Re33") rmEnumeratorName(xx) rmEnumeratorName(xx, newSep="--") rmEnumeratorName(xx, incl="anyCase") xy <- cbind(a=11:13, b=c("11#11","2_No2","333_samp333"), c=xx) rmEnumeratorName(xy) rmEnumeratorName(xy,incl=c("anyCase","trim2","rmEnumL")) xz <- cbind(a=11:13, b=c("23#11","4#2","567#333"), c=xx) apply(xz, 2, rmEnumeratorName, sepEnum=c("","_"), newSep="_", silent=TRUE)
This function allows detecting terminal orphans of a vector of (cluster-) indexes and removing (ie marking as NA)
or re-assigning them to the neighbour class towrds the center.
rmOrphans( ind, minN = 1, reassign = FALSE, side = "both", silent = FALSE, debug = FALSE, callFrom = NULL )rmOrphans( ind, minN = 1, reassign = FALSE, side = "both", silent = FALSE, debug = FALSE, callFrom = NULL )
ind |
(integer) main input of (cluster-) indexes |
minN |
(numeric, length=1) the min frequency to consider as orphans, if less than 1 it will be interpreted as ratio compared to length of |
reassign |
(logical) if |
side |
(character) may be 'both', 'b', 'upper', 'u', 'lower' or 'l' to decide if lower and/or upper end indexes should be treated. |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
All input of ind is supposed to be interger values as (cluster-) indexes.
This function will look if the lowest and/or highest (cluster-) indexes appear at very low frequency so that they may be considered orphans.
The argument minN assigns the threshold of when the frquency of terminal values may be considered as 'orphan',
either as absolute threshold or if less than 1 as ratio (0.1 => 10
The argument side may be 'both', 'b', 'upper', 'u', 'lower' or 'l', to decide if lower and/or upper end indexes should be treated.
This function returns an integer vector of adjusted indexes
x=c(3:1,3:4,4:6,5:3); rmOrphans(x) rmOrphans(x, minN=0.2) ## reassign orphans to neighbour center class cbind(x, x=x, def=rmOrphans(x, reassign=TRUE), minN=rmOrphans(x, minN=0.2, reassign=TRUE) )x=c(3:1,3:4,4:6,5:3); rmOrphans(x) rmOrphans(x, minN=0.2) ## reassign orphans to neighbour center class cbind(x, x=x, def=rmOrphans(x, reassign=TRUE), minN=rmOrphans(x, minN=0.2, reassign=TRUE) )
This function allows creating a vector of random values similar to rnorm, but resulting value get recorrected to fit to expected mean and sd.
When the number of random values to generate is low, the mean and sd of the resultant values may deviate from the expected mean and sd when using the standard rnorm function.
In such cases the function rnormW helps getting much closer to the expected mean and sd.
rnormW( n, mean = 0, sd = 1, seed = NULL, digits = 8, silent = FALSE, callFrom = NULL )rnormW( n, mean = 0, sd = 1, seed = NULL, digits = 8, silent = FALSE, callFrom = NULL )
n |
(integer, length=1) number of observations. If |
mean |
(numeric, length=1) expected mean |
sd |
(numeric, length=1) expected sd |
seed |
(integer, length=1) seed for generating random numbers |
digits |
(integer, length=1 or |
silent |
(logical) suppress messages |
callFrom |
(character) allow easier tracking of messages produced |
For making result reproducible, a seed for generating random numbers can be set via the argument seed.
However, with n=2 the resulting values are 'fixed' since no random component is possible at n <3.
This function returns a numeric vector of random values
x1 <- (11:16)[-5] mean(x1); sd(x1) ## the standard way ra1 <- rnorm(n=length(x1), mean=mean(x1), sd=sd(x1)) ## typically the random values deviate (slightly) from expected mean and sd mean(ra1) -mean(x1) sd(ra1) -sd(x1) ## random numbers with close fit to expected mean and sd : ra2 <- rnormW(length(x1), mean(x1), sd(x1)) mean(ra2) -mean(x1) sd(ra2) -sd(x1) # much closer to expected valuex1 <- (11:16)[-5] mean(x1); sd(x1) ## the standard way ra1 <- rnorm(n=length(x1), mean=mean(x1), sd=sd(x1)) ## typically the random values deviate (slightly) from expected mean and sd mean(ra1) -mean(x1) sd(ra1) -sd(x1) ## random numbers with close fit to expected mean and sd : ra2 <- rnormW(length(x1), mean(x1), sd(x1)) mean(ra2) -mean(x1) sd(ra2) -sd(x1) # much closer to expected value
This function returns CV for values in each row (using speed optimized standard deviation). Note : NaN values get replaced by NA.
rowCVs(dat, autoconvert = NULL, silent = FALSE, debug = FALSE, callFrom = NULL)rowCVs(dat, autoconvert = NULL, silent = FALSE, debug = FALSE, callFrom = NULL)
dat |
(numeric) matix |
autoconvert |
(NULL or character) allows converting simple vectors in matrix of 1 row (autoconvert="row") |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
This function returns a (numeric) vector with CVs for each row of 'dat'
colSums, rowSds, rowGrpCV, colCVs
set.seed(2016); dat1 <- matrix(c(runif(200) +rep(1:10,20)), ncol=10) head(rowCVs(dat1))set.seed(2016); dat1 <- matrix(c(runif(200) +rep(1:10,20)), ncol=10) head(rowCVs(dat1))
This function calculates CVs for matrix with multiple groups of data, ie one CV for each group of data. Groups are specified as columns of 'x' in 'grp' (so length of grp should match number of columns of 'x', NAs are allowed)
rowGrpCV(x, grp, means = NULL, listOutp = FALSE)rowGrpCV(x, grp, means = NULL, listOutp = FALSE)
x |
numeric matrix where relplicates are organized into separate columns |
grp |
(factor) defining which columns should be grouped (considered as replicates) |
means |
(numeric) alternative values instead of means by .rowGrpMeans() |
listOutp |
(logical) if TRUE, provide output as list with $CV, $mean and $n |
This function returns a matrix of CV values
set.seed(2016); dat1 <- matrix(c(runif(200)+rep(1:10,20)),ncol=10) head(rowGrpCV(dat1, gr=gl(4,3,labels=LETTERS[1:4])[2:11]))set.seed(2016); dat1 <- matrix(c(runif(200)+rep(1:10,20)),ncol=10) head(rowGrpCV(dat1, gr=gl(4,3,labels=LETTERS[1:4])[2:11]))
Thus function calculates column-means for matrix with multiple groups of data, ie similar to rowMeans but one mean for each group of data. Groups are specified as columns of 'x' in 'grp' (so length of grp should match number of columns of 'x', NAs are allowed).
rowGrpMeans( x, grp, na.rm = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )rowGrpMeans( x, grp, na.rm = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )
x |
(numeric matrix or data.frame) main input |
grp |
(character or factor) defining which columns should be grouped (considered as replicates) |
na.rm |
(logical) a logical value indicating whether |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) This function allows easier tracking of messages produced |
This function returns a matrix with mean values
rowSds, colSums which also shows colMeans
set.seed(2016); dat1 <- matrix(c(runif(200) +rep(1:10,20)), ncol=10) head(rowGrpMeans(dat1, gr=gl(4, 3, labels=LETTERS[1:4])[2:11]))set.seed(2016); dat1 <- matrix(c(runif(200) +rep(1:10,20)), ncol=10) head(rowGrpMeans(dat1, gr=gl(4, 3, labels=LETTERS[1:4])[2:11]))
This functions allows easy counting of the number of NAs per row and group in data organized multiple sub-groups (in columns).
rowGrpNA( mat, grp = NULL, initColOrder = TRUE, mode = "simple", digits = 2, silent = FALSE, debug = FALSE, callFrom = NULL )rowGrpNA( mat, grp = NULL, initColOrder = TRUE, mode = "simple", digits = 2, silent = FALSE, debug = FALSE, callFrom = NULL )
mat |
(matrix, data.frame, list or 'MArrayLM') data to count the number of |
grp |
(character or factor) defining which columns should be grouped (considered as replicates). If |
initColOrder |
(logical) if |
mode |
(character) allows to switch between different types of output :
|
digits |
(integer, length=1) number of decimal digits from rounding (when ratios are calculated); |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
First of all, this function allows counting the number of NAs per line and sub-group of columns as defined by argument grp.
Furthermore, the counting can be expressed relative to the size of the sub-groups, either as ratio or by giving the NA-count
using mode and all results may also get collasped in as single (character) vector, however, the names of the groups do not get conserved.
This function has several options via tehe argument 'mode':
- mode="simple" will return simply the number of NAs per line and group as integer;
- mode="simpleCollapse" will collapse all columns into single chain of characters with the number of NAs per line and group (as character);
- mode="complete" will return number of NAs per line and group accompanied by the number of columns associated with the very group (as character);
- mode="completeCollapse" will collapse all columns into single chain of characters with the number of NAs per line and group accompanied by the number of columns associated with the very group (as character);
- mode="ratio" will return the ratio of NAs per line and group (as numeric);
- mode="ratioCollapse" will collapse all columns into single chain of characters with the ratio of NAs per line and group(as character);
With mode="complete" or mode="ratio" the resulting column-names will state 'nNA.' plus 'ratio.' (if a ratio-mode was chosen).
This function returns a matrix (or numeric vector if all grouping falls in a single class or charcter-vector if all groups get collapsed in single chain of characters) with number of NAs per group
mat2 <- matrix(1:72, nrow=9, ncol=8, dimnames=list(letters[1:9],LETTERS[1:8])) set.seed(2025); mat2[sample.int(prod(dim(mat2)), 2*nrow(mat2), replace=FALSE)] <- NA set.seed(2026); grp2 <- as.factor(sample.int(n=3, size=ncol(mat2), replace=TRUE)) table(grp2) ## overal number of NAs per row rowSums(is.na(mat2)) ## number of NAs per row and group head(rowGrpNA(mat2, grp2)) head(rowGrpNA(mat2, grp2, mode="complete")) head(rowGrpNA(mat2, grp2, mode="ratio")) ## mimick output from testing from package wrProteo dat1 <- list(isNA =is.na(mat2), setup=list(grp=grp2)) head(rowGrpNA(dat1, mode="simple")) head(rowGrpNA(dat1, mode="complete")) head(rowGrpNA(dat1, mode="ratioCollapse"))mat2 <- matrix(1:72, nrow=9, ncol=8, dimnames=list(letters[1:9],LETTERS[1:8])) set.seed(2025); mat2[sample.int(prod(dim(mat2)), 2*nrow(mat2), replace=FALSE)] <- NA set.seed(2026); grp2 <- as.factor(sample.int(n=3, size=ncol(mat2), replace=TRUE)) table(grp2) ## overal number of NAs per row rowSums(is.na(mat2)) ## number of NAs per row and group head(rowGrpNA(mat2, grp2)) head(rowGrpNA(mat2, grp2, mode="complete")) head(rowGrpNA(mat2, grp2, mode="ratio")) ## mimick output from testing from package wrProteo dat1 <- list(isNA =is.na(mat2), setup=list(grp=grp2)) head(rowGrpNA(dat1, mode="simple")) head(rowGrpNA(dat1, mode="complete")) head(rowGrpNA(dat1, mode="ratioCollapse"))
rowGrpSds calculate Sd (standard-deviation) for matrix with multiple groups of data, ie one sd for each group of data.
Groups are specified as columns of 'x' in 'grp' (so length of grp should match number of columns of 'x', NAs are allowed).
rowGrpSds(x, grp)rowGrpSds(x, grp)
x |
matrix where relplicates are organized into seprate columns |
grp |
(character or factor) defining which columns should be grouped (considered as replicates) |
This function returns a matrix of sd values
rowGrpMeans, rowCVs, rowSEMs,sd
set.seed(2016); dat1 <- matrix(c(runif(200) +rep(1:10,20)), ncol=10) head(rowGrpSds(dat1, gr=gl(4,3,labels=LETTERS[1:4])[2:11]))set.seed(2016); dat1 <- matrix(c(runif(200) +rep(1:10,20)), ncol=10) head(rowGrpSds(dat1, gr=gl(4,3,labels=LETTERS[1:4])[2:11]))
This function calculates row-sums for matrix with multiple groups of data, ie similar to rowSums but one summed value for each line and group of data.
Groups are specified as columns of 'x' in 'grp' (so length of grp should match number of columns of 'x', NAs are allowed).
rowGrpSums(x, grp, na.rm = TRUE)rowGrpSums(x, grp, na.rm = TRUE)
x |
matrix or data.frame |
grp |
(character or factor) defining which columns should be grouped (considered as replicates) |
na.rm |
(logical) a logical value indicating whether |
This function a matrix with row/group sum values
rowGrpMeans, rowGrpSds, rowSds, colSums
set.seed(2016); dat1 <- matrix(c(runif(200) +rep(1:10,20)), ncol=10) head(rowGrpMeans(dat1, gr=gl(4, 3, labels=LETTERS[1:4])[2:11]))set.seed(2016); dat1 <- matrix(c(runif(200) +rep(1:10,20)), ncol=10) head(rowGrpMeans(dat1, gr=gl(4, 3, labels=LETTERS[1:4])[2:11]))
This function determines the stand error (sd) of the median for each row by bootstraping each row of 'dat'. Note: requires package boot
rowMedSds(dat, nBoot = 99, silent = FALSE, debug = FALSE, callFrom = NULL)rowMedSds(dat, nBoot = 99, silent = FALSE, debug = FALSE, callFrom = NULL)
dat |
(numeric) matix, main input |
nBoot |
(integer) number if iterations for bootstrap |
silent |
(logical) suppress messages |
debug |
(logical) display additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
This functions returns a (numeric) vector with estimated sd values
For a more flexible version able to handle lists please look at colMedSds , based on boot
set.seed(2016); dat1 <- matrix(c(runif(200)+rep(1:10,20)), ncol=10) rowMedSds(dat1) ; plot(rowSds(dat1), rowMedSds(dat1))set.seed(2016); dat1 <- matrix(c(runif(200)+rep(1:10,20)), ncol=10) rowMedSds(dat1) ; plot(rowSds(dat1), rowMedSds(dat1))
This function was designed for normalizing data that is supposed to be particularly similar, like a collection of technical replicates.
Thus, initially for each row an independent normalization factor is calculated and the median or mean across all factors will be finally applied to the data.
This function has a special mode of operation with higher content of NA values (which may pose problems with other normalization approaches).
If the NA-content is higher than the threshold set in sparseLim,
a special procedure for sparse data will be applied (iteratively trating subsets of nCombin columns that will be combined in a later step).
rowNormalize( dat, method = "median", refLines = NULL, refGrp = NULL, proportMode = TRUE, minQuant = NULL, sparseLim = 0.4, nCombin = 3, omitNonAlignable = FALSE, maxFact = 10, silent = FALSE, debug = FALSE, callFrom = NULL )rowNormalize( dat, method = "median", refLines = NULL, refGrp = NULL, proportMode = TRUE, minQuant = NULL, sparseLim = 0.4, nCombin = 3, omitNonAlignable = FALSE, maxFact = 10, silent = FALSE, debug = FALSE, callFrom = NULL )
dat |
matrix or data.frame of data to get normalized |
method |
(character) may be "mean","median" (plus "NULL","none"); When NULL or 'none' is chosen the input will be returned as is |
refLines |
(NULL or numeric) allows to consider only specific lines of 'dat' when determining normalization factors (all data will be normalized) |
refGrp |
(integer) Only the columns indicated will be used as reference, default all columns (integer or colnames) |
proportMode |
(logical) decide if normalization should be done by multiplicative or additive factor |
minQuant |
(numeric) optional filter to set all values below given value as |
sparseLim |
(integer) decide at which min content of |
nCombin |
(NULL or integer) used only in sparse-mode (ie if content of |
omitNonAlignable |
(logical) allow omitting all columns which can't get aligned due to sparseness |
maxFact |
(numeric, length=2) max normalization factor |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
Arguments were kept similar with function normalizeThis as much as possible.
In most cases data get normalized by proportional factors. In case of log2-data (very common in omics-data) normalizing by an additive factor is equivalent to a proportional factor.
This function has a special mode of operation for sparse data (ie containing a high content of NA values).
0-values by themselves will be primarily considered as true measurment outcomes and not as missing.
However, by using the argument minQuant all values below a given threshold will be set as NA and this may possibly trigger the sparse mode of normalizing.
Note : Using a small value of nCombin will give the highest chances of finding sufficient complete combination of columns with sparse data.
However, this will also increase (very much) the computational efforts and time required to produce an output.
When using default proportional mode a potential division by 0 could occur, when the initial normalization factor turns out as 0.
In this case a small value (default the maximum value of dat / 10 will be added to all data before normalizing.
If this also creates 0-vales in the data this factor will be multiplied by 0.03.
This function returns a matrix of normalized data
normalizeThis, exponNormalize, adjBy2ptReg, justvsn
## sparse matrix normalization set.seed(2); AA <- matrix(rbinom(110,10,0.05), nrow=10) AA[,4:5] <- AA[,4:5] *rep(4:3, each=nrow(AA)) AA[2,c(2,6,7)] <- 1; AA[3,8] <- 1; (AA1 <- rowNormalize(AA)) (AA2 <- rowNormalize(AA, minQuant=1)) # set all 0 as NAs (AA3 <- rowNormalize(AA, refLines=1:6, omitNonAlignable=FALSE, minQuant=1))## sparse matrix normalization set.seed(2); AA <- matrix(rbinom(110,10,0.05), nrow=10) AA[,4:5] <- AA[,4:5] *rep(4:3, each=nrow(AA)) AA[2,c(2,6,7)] <- 1; AA[3,8] <- 1; (AA1 <- rowNormalize(AA)) (AA2 <- rowNormalize(AA, minQuant=1)) # set all 0 as NAs (AA3 <- rowNormalize(AA, refLines=1:6, omitNonAlignable=FALSE, minQuant=1))
This function is speed optimized sd per row of a matrix or data.frame and treats each row as independent set of data for sd (equiv to apply(dat,1,sd)).
NAs are ignored from data unless entire line NA). Speed improvements may be seen at more than 100 lines.
Note: NaN instances will be transformed to NA
rowSds(dat, silent = FALSE, debug = FALSE, callFrom = NULL)rowSds(dat, silent = FALSE, debug = FALSE, callFrom = NULL)
dat |
matrix (or data.frame) with numeric values (may contain NAs which will be ignored) |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
numeric vector of sd values
set.seed(2016); dat1 <- matrix(c(runif(200)+rep(1:10,20)),ncol=10) rowSds(dat1)set.seed(2016); dat1 <- matrix(c(runif(200)+rep(1:10,20)),ncol=10) rowSds(dat1)
This function speed optimized SEM (standard error of the mean) for each row. The function takes a matrix or data.frame and treats each row as set of data for SEM; NAs are ignored from data. Note: NaN instances will be transformed to NA
rowSEMs(dat)rowSEMs(dat)
dat |
matrix or data.frame |
This function returns a numeric vector with SEM values
set.seed(2016); dat1 <- matrix(c(runif(200)+rep(1:10,20)),ncol=10) head(rowSEMs(dat1))set.seed(2016); dat1 <- matrix(c(runif(200)+rep(1:10,20)),ncol=10) head(rowSEMs(dat1))
When multiple series of data are tested simultaneaously (eg using moderTestXgrp), multiple pairwise comparisons get performed.
This function helps locating the groups of samples, eg respective mean-columns, corresponding to specific pairwise comparisons.
sampNoDeMArrayLM( MArrayObj, useComp = NULL, outTy = "index", groupSep = NULL, combPwSep = "combine1", silent = FALSE, debug = FALSE, callFrom = NULL )sampNoDeMArrayLM( MArrayObj, useComp = NULL, outTy = "index", groupSep = NULL, combPwSep = "combine1", silent = FALSE, debug = FALSE, callFrom = NULL )
MArrayObj |
(list or MArray-object) main input, object to examine and extract pairwise question information |
useComp |
(character or integer, length=1) index or name of pairwise-comparison to be addressed |
outTy |
(character) choose if just vector of indexes (with |
groupSep |
(NULL or character of length=1) separator for pair of names; if |
combPwSep |
(character) sequence of separators for building combined names (may be combPwSep='combine1' or 'combine2'); will be used in pwSeparatorList() |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
As main input one gives a list or MArrayLM-object containing testing results from pairwise comparisons,
and specific comparisons indicated by useComp to get located in the elements of mean-columns (lstMeans).
Note, that that the numeric indexes should be used with caution as they refer to the levels of the groups which are sorted and thus not necessarily in the order of other elements like the group-means.
This function allows finding inverted questions (eg 'D-C' even though 'C-D' was actually run in testing), but the result will always be presented in the initial order
This function returns if outTy="names" a numeric vector with indexes indicating the sorted (!!) columns of (replicate) mean-values corresponding to the comparison specified in useComp;
or if outTy="names" or outTy="pwGrpNa" : the (separated) names of pairwise groups will be returned as matrix (each pairwise question as separate line)
or if outTy="list" a list with $index0 (sorted unique vector or indexes), $pwGrpNa (the separated pairwise group-names), $pwIndex (the ith pairwise comparison), $concat (the concatenated pairwise names), $sep (pairwise separator) and $compIndex
moderTestXgrp, this function gets used eg in MAplotW or VolcanoPlotW
grp3 <- factor(rep(LETTERS[4:2], c(2,3,3))) set.seed(2017); t8 <- matrix(round(rnorm(208*8,10,0.4), 2), ncol=8, dimnames=list(paste(letters[],rep(1:8,each=26),sep=""), paste0(grp3,c(1:2,1:3,1:3)))) if(requireNamespace("limma", quietly=TRUE)) { # need limma installed... test8 <- moderTestXgrp(t8, grp3, useComparison="all") head(test8$p.value) # all pairwise comparisons available sampNoDeMArrayLM(test8, 3) levels(grp3)[sampNoDeMArrayLM(test8, 3)] head(test8$means[,sampNoDeMArrayLM(test8, 3, outTy="names")], 3) head(test8$means[,sampNoDeMArrayLM(test8, "D-C", outTy="names")], 3) # inverted question }grp3 <- factor(rep(LETTERS[4:2], c(2,3,3))) set.seed(2017); t8 <- matrix(round(rnorm(208*8,10,0.4), 2), ncol=8, dimnames=list(paste(letters[],rep(1:8,each=26),sep=""), paste0(grp3,c(1:2,1:3,1:3)))) if(requireNamespace("limma", quietly=TRUE)) { # need limma installed... test8 <- moderTestXgrp(t8, grp3, useComparison="all") head(test8$p.value) # all pairwise comparisons available sampNoDeMArrayLM(test8, 3) levels(grp3)[sampNoDeMArrayLM(test8, 3)] head(test8$means[,sampNoDeMArrayLM(test8, 3, outTy="names")], 3) head(test8$means[,sampNoDeMArrayLM(test8, "D-C", outTy="names")], 3) # inverted question }
This function allows convenient rescaling of data in the sence that the range covered will be adjusted to user-specified values. Instead of fixed min and max values for the output it is also possible to fix 2 given quantiles for user-specified values (and rescale by linear transformation).
scaleXY( x, min = 0, max = NULL, q = c(0, 1), silent = FALSE, debug = FALSE, callFrom = NULL )scaleXY( x, min = 0, max = NULL, q = c(0, 1), silent = FALSE, debug = FALSE, callFrom = NULL )
x |
(numeric vector, matrix or data.frame) object to rescacle |
min |
(numeric) minimum value in output, if of length=2 and max not given/valid its 2nd value will be used as max |
max |
(numeric) maximum value in output, defaults to 1 if not specified or use 2nd value of min (if min of length=2) |
q |
(numeric, length=2) vector giving quantile values to be used for setting frame of normalization (defaults to lowest and highest values expected) |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns a vector (or matrix) of rescaled data (in dimensions of input)
scale, normalizeThis, blockNormalize
## simple vector scale(11:19) # standardizes (base R), is not 'rescaling' scaleXY(11:19) # range form 0 to 1 scaleXY(11:19, min=1, max=10) scaleXY(11:19, c(1, 10)) # min & max as single argument # rescale matrix with NA ## rescale to 20th and 80th quantile (ie other than min or max) scaleXY(11:19, min=1, max=10, q=c(0.2, 0.8)) ## rescale matrix with NA mat1 <- matrix(11:20, ncol=2, dimnames=list(letters[1:5], c("A","B"))) mat1[2,1] <- NA scaleXY(mat1) scaleXY(mat1, min=1, max=10, q=c(0.2, 0.8)) ## rescale for each column individually dat2 <- apply(mat1, 2, scaleXY, 1, 100) range(dat2) summary(dat2)## simple vector scale(11:19) # standardizes (base R), is not 'rescaling' scaleXY(11:19) # range form 0 to 1 scaleXY(11:19, min=1, max=10) scaleXY(11:19, c(1, 10)) # min & max as single argument # rescale matrix with NA ## rescale to 20th and 80th quantile (ie other than min or max) scaleXY(11:19, min=1, max=10, q=c(0.2, 0.8)) ## rescale matrix with NA mat1 <- matrix(11:20, ncol=2, dimnames=list(letters[1:5], c("A","B"))) mat1[2,1] <- NA scaleXY(mat1) scaleXY(mat1, min=1, max=10, q=c(0.2, 0.8)) ## rescale for each column individually dat2 <- apply(mat1, 2, scaleXY, 1, 100) range(dat2) summary(dat2)
searchDataPairs searches matrix for columns of similar data, ie 'duplicate' values in separate columns or very similar columns if realDupsOnly=FALSE.
Initial distance measures will be normalized either to diagonale (normRange=TRUE) of 'window' or to the real max distance observed (equal or less than diagonale).
Return data.frame with names for sample-pair, percent of identical values (100 for complete identical pair) and relative (Euclidean) distance (ie max dist observed =1.0).
Note, that low distance values do not necessarily imply correlating data.
searchDataPairs( dat, disThr = 0.01, byColumn = TRUE, normRange = TRUE, altNa = NULL, realDupsOnly = TRUE, silent = FALSE, callFrom = NULL )searchDataPairs( dat, disThr = 0.01, byColumn = TRUE, normRange = TRUE, altNa = NULL, realDupsOnly = TRUE, silent = FALSE, callFrom = NULL )
dat |
matrix or data.frame (main input) |
disThr |
(numeric) threshold to decide when to report similar data (applied on normalized distances, low val fewer reported), applied on normalized distances (norm to diagonale of all data for best relative 'unbiased' view) |
byColumn |
(logical) rotates main input by 90 degrees (using |
normRange |
(logical) normize each columns separately if |
altNa |
(character, default |
realDupsOnly |
(logical) if |
silent |
(logical) suppres messages |
callFrom |
(character) allows easier tracking of messages produced |
This function returns a data.frame with names of sample-pairs, percent of identical values (100 for complete identical pair) and rel (Euclidean) distance (ie max dist observed =1.0)
mat <- round(matrix(c(11:40,runif(20)+12,11:19,17,runif(20)+18,11:20), nrow=10), 1) colnames(mat) <- 1:9 searchDataPairs(mat,disThr=0.05)mat <- round(matrix(c(11:40,runif(20)+12,11:19,17,runif(20)+18,11:20), nrow=10), 1) colnames(mat) <- 1:9 searchDataPairs(mat,disThr=0.05)
This function searches among set of points (2-dim) those forming line(s) with user-defined slope ('coeff'), ie search optimal (slope-) offset parameter(s) for (regression) line(s) with given slope ('coef'). Note: larger data-sets : segment residuals to 'coeff' & select most homogenous
searchLinesAtGivenSlope( dat, coeff = 1.5, filtExtr = c(0, 1), minMaxDistThr = NULL, lmCompare = TRUE, indexPoints = TRUE, displHist = FALSE, displScat = FALSE, bestCluByDistRat = TRUE, neighbDiLim = NULL, silent = FALSE, debug = FALSE, callFrom = NULL )searchLinesAtGivenSlope( dat, coeff = 1.5, filtExtr = c(0, 1), minMaxDistThr = NULL, lmCompare = TRUE, indexPoints = TRUE, displHist = FALSE, displScat = FALSE, bestCluByDistRat = TRUE, neighbDiLim = NULL, silent = FALSE, debug = FALSE, callFrom = NULL )
dat |
matrix or data.frame, main input |
coeff |
(numeric) slope to consider |
filtExtr |
(integer) lower & upper quantile values, remove points with extreme deviation to offset=0, (if single value: everything up to or after will be used) |
minMaxDistThr |
(logical) optional minumum and maximum distance threshold |
lmCompare |
(logical) add'l fitting of linear regression to best results, return offset AND slope based on lm fit |
indexPoints |
(logical) return results as list with element 'index' specifying retained points |
displHist |
(logical) display histogram of residues |
displScat |
(logical) display (simple) scatter plot |
bestCluByDistRat |
(logical) initial selection of decent clusters based on ratio overallDist/averNeighbDist (or by CV & cor) |
neighbDiLim |
(numeric) additional threshold for (trimmed mean) neighbour-distance |
silent |
(logical) suppress messages |
debug |
(logical) for bug-tracking: more/enhanced messages |
callFrom |
(character) allow easier tracking of messages produced |
Note: The package MASS is required when using as lmCompare=TRUE.
For larger data the function will try using the package NbClust (available from CRAN) if installed.
This functions returns a matrix of line-characteristics (or if indexPoints is TRUE then list (line-characteristics & index & lm-results)
set.seed(2016); ra1 <- runif(300) dat1 <- cbind(x=round(c(1:100+ra1[1:100]/5,4*ra1[1:50]),1), y=round(c(1:100+ra1[101:200]/5, 4*ra1[101:150]), 1)) (li1 <- searchLinesAtGivenSlope(dat1, coeff=1))set.seed(2016); ra1 <- runif(300) dat1 <- cbind(x=round(c(1:100+ra1[1:100]/5,4*ra1[1:50]),1), y=round(c(1:100+ra1[101:200]/5, 4*ra1[101:150]), 1)) (li1 <- searchLinesAtGivenSlope(dat1, coeff=1))
Simple Figure Showing Line From Start- To End-Sites Of Edges (Or Fragments) Defined By Their Start- And End-Sites
This function draws av figure showing start- and end-sites of edges (or fragments) .
simpleFragFig( frag, fullSize = NULL, sortByHead = TRUE, useTit = NULL, useCol = NULL, displNa = TRUE, useCex = 0.7 )simpleFragFig( frag, fullSize = NULL, sortByHead = TRUE, useTit = NULL, useCol = NULL, displNa = TRUE, useCex = 0.7 )
frag |
(matrix) 2 columns defining begin- and end-sites (as interger values) |
fullSize |
(integer) optional max size used for figure (x-axis) |
sortByHead |
(logical) sort by begin-sites (if |
useTit |
(character) custom title |
useCol |
(character) specify colors, if numeric vector will be onsidered as score values |
displNa |
(character) display names of edges (figure may get crowded) |
useCex |
(numeric) expansion factor, see also |
This function returns a plot only
buildTree, countSameStartEnd, contribToContigPerFrag,
frag2 <- cbind(beg=c(2,3,7,13,13,15,7,9,7, 3,7,5,7,3),end=c(6,12,8,18,20,20,19,12,12, 4,12,7,12,4)) rownames(frag2) <- c("A","E","B","C","D","F","H","G","I", "J","K","L","M","N") simpleFragFig(frag2, fullSize=21, sortByHead=TRUE) buildTree(frag2)frag2 <- cbind(beg=c(2,3,7,13,13,15,7,9,7, 3,7,5,7,3),end=c(6,12,8,18,20,20,19,12,12, 4,12,7,12,4)) rownames(frag2) <- c("A","E","B","C","D","F","H","G","I", "J","K","L","M","N") simpleFragFig(frag2, fullSize=21, sortByHead=TRUE) buildTree(frag2)
This function runs 2-factorial Anova on a single line of data (using aov from package stats)
using a model with two factors (without factor-interaction) and extracts the correpsonding p-value.
singleLineAnova( dat, fac1, fac2, inclInteraction = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )singleLineAnova( dat, fac1, fac2, inclInteraction = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )
dat |
numeric vector |
fac1 |
(character or factor) vector describing grouping elements of dat for first factor, must be of same langth as fac2 |
fac2 |
(character or factor) vector describing grouping elements of dat for second factor, must be of same langth as fac1 |
inclInteraction |
(logical) decide if factor-interactions (eg synergy) should be included to model |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns the (uncorrected) p for factor 'Pr(>F)' (see aov)
aov, anova; for repeated tests using the package limma including lmFit and eBayes see test2factLimma
set.seed(2012); dat <- round(runif(8),1) singleLineAnova(dat, gl(2,4),rep(1:2,4))set.seed(2012); dat <- round(runif(8),1) singleLineAnova(dat, gl(2,4),rep(1:2,4))
This function sorts matrix 'mat' subsequently by categorical and numerical columns of 'mat', ie lines with identical values for categor are sorted by numeric value.
sortBy2CategorAnd1IntCol( mat, categCol, numCol, findNeighb = TRUE, decreasing = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )sortBy2CategorAnd1IntCol( mat, categCol, numCol, findNeighb = TRUE, decreasing = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )
mat |
matrix (or data.frame) from which by 2 columns will be selected for sorting |
categCol |
(integer or character) which columns of 'mat' to be used as categorical columns |
numCol |
(integer or character) which column of 'mat' to be used as integer columns |
findNeighb |
(logical) if 'findNeighb' neighbour cols according to 'numCol' will be identified as groups & marked in new col 'neiGr', orphans marked as NA |
decreasing |
(logical) order of sort |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns a sorted matrix (same dimensions as 'mat')
mat <- cbind(aa=letters[c(3,rep(7:8,3:4),4,4:6,7)],bb=LETTERS[rep(1:5,c(1,3,4,4,1))], nu=c(23:21,23,21,22,18:12)) mat[c(3:5,1:2,6:9,13:10),] sortBy2CategorAnd1IntCol(mat,cate=c("bb","aa"),num="nu",findN=FALSE,decr=TRUE) sortBy2CategorAnd1IntCol(mat,cate=c("bb","aa"),num="nu",findN=TRUE,decr=FALSE)mat <- cbind(aa=letters[c(3,rep(7:8,3:4),4,4:6,7)],bb=LETTERS[rep(1:5,c(1,3,4,4,1))], nu=c(23:21,23,21,22,18:12)) mat[c(3:5,1:2,6:9,13:10),] sortBy2CategorAnd1IntCol(mat,cate=c("bb","aa"),num="nu",findN=FALSE,decr=TRUE) sortBy2CategorAnd1IntCol(mat,cate=c("bb","aa"),num="nu",findN=TRUE,decr=FALSE)
The aim of this function is to count the number of occurances of words when comaring separate vectors (x, y and z) or from a list (given as x)
and to give an output sorted by their frequency.
The output lists the various values/words by their frequency, the names of the resulting list-elements indicate number of times the values/words were found repeated.
sortByNRepeated( x, y = NULL, z = NULL, filterIntraRep = TRUE, silent = TRUE, debug = FALSE, callFrom = NULL )sortByNRepeated( x, y = NULL, z = NULL, filterIntraRep = TRUE, silent = TRUE, debug = FALSE, callFrom = NULL )
x |
(list, character or integer) main input, if list, arguments |
y |
(character or integer) supplemental vector to comare with |
z |
(character or integer) supplemental vector to comare with |
filterIntraRep |
(logical) allow making vectors |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
In order to compare the frquency of values/words between separate vectors or vectors within a list, it is necessary that these have been made unique before calling this function or using filterIntraRep=TRUE.
In case the input is given as list (in x), there is no restriction to the number of vectors to be compared.
With very long lists, however, the computational effort incerases (like it does when using table)
This function returns a list sorted by number of occurances. The names of the list indicate the number of repeats.
sortByNRepeated(x=LETTERS[1:11], y=LETTERS[3:13], z=LETTERS[6:12]) sortByNRepeated(x=LETTERS[1:11], y=LETTERS[c(3:13,5:4)], z=LETTERS[6:12])sortByNRepeated(x=LETTERS[1:11], y=LETTERS[3:13], z=LETTERS[6:12]) sortByNRepeated(x=LETTERS[1:11], y=LETTERS[c(3:13,5:4)], z=LETTERS[6:12])
Estimate mode, ie most frequent value. In case of continuous numeric data, the most frequent values may not be the most frequently repeated exact term. This function offers various approches to estimate the mode of a numeric vector. Besides, it can also be used to identify the most frequentexact term (in this case also from character vectors).
stableMode( x, method = "density", finiteOnly = TRUE, bandw = NULL, rangeSign = 1:6, silent = FALSE, callFrom = NULL, debug = FALSE )stableMode( x, method = "density", finiteOnly = TRUE, bandw = NULL, rangeSign = 1:6, silent = FALSE, callFrom = NULL, debug = FALSE )
x |
(numeric, or character if 'method='mode') data to find/estimate most frequent value |
method |
(character) There are 3 options : BBmisc, binning and density (default). If "binning" the function will search context dependent, ie like most frequent class of histogram. Using "binning" mode the search will be refined if either 80 percent of values in single class or >50 percent in single class. |
finiteOnly |
(logical) suppress non-finite values; allows avoiding |
bandw |
(integer) only used when |
rangeSign |
(integer) only used when |
silent |
(logical) suppress messages |
callFrom |
(character) allows easier tracking of messages produced |
debug |
(logical) additional messages for debugging |
The argument method allows to choose among (so far) 4 different methods available.
If "density" is chosen, the most dense region of sqrt(n) values will be chosen;
if "binning", the data will be binned (like in histograms) via rounding to a user-defined number of significant values ("rangeSign").
If method is set to "BBmisc", the function computeMode() from package BBmisc will be used.
If "mode" is chosen, the first most frequently occuring (exact) value will be returned, if "allModes", all ties will be returned. This last mode also works with character input.
This function returns a numeric vector with value of mode, the name of the value indicates it's position
computeMode() in package BBmisc
set.seed(2012); dat <- round(c(rnorm(50), runif(100)),3) stableMode(dat)set.seed(2012); dat <- round(c(rnorm(50), runif(100)),3) stableMode(dat)
This functions work similar to scale, however, it evaluates the entire input and not column-wise (and independeltly as scale does).
With Standarizing we speak of transforming the data to end up with mean=O and sd=1.
Furthermore, in case of 3-dim arrays, this function returns also an object with the same dimensions as the input.
standardW( mat, byColumn = FALSE, na.rm = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )standardW( mat, byColumn = FALSE, na.rm = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )
mat |
(matrix, data.frame or array) data that need to get standardized. |
byColumn |
(logical) if |
na.rm |
(logical) if |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This functions retruns a vector of rescaled data (in dimensions as input)
dat <- matrix(2*round(runif(100),2), ncol=4) mean(dat); sd(dat) dat2 <- standardW(dat) apply(dat2, 2, sd) summary(dat2) dat3 <- standardW(dat, byColumn=TRUE) apply(dat2, 2, sd) summary(dat2) mean(dat2); sd(dat2)dat <- matrix(2*round(runif(100),2), ncol=4) mean(dat); sd(dat) dat2 <- standardW(dat) apply(dat2, 2, sd) summary(dat2) dat3 <- standardW(dat, byColumn=TRUE) apply(dat2, 2, sd) summary(dat2) mean(dat2); sd(dat2)
stdErrMedBoot estimate standard eror of median by bootstrap approach.
Note: requires package boot
stdErrMedBoot(x, nBoot = 9, silent = FALSE, debug = FALSE, callFrom = NULL)stdErrMedBoot(x, nBoot = 9, silent = FALSE, debug = FALSE, callFrom = NULL)
x |
(numeric) vector to estimate median and it's standard error |
nBoot |
(integer) number for iterations |
silent |
(logical) suppress messages |
debug |
(logical) display additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
This function returns a (numeric) vector with estimated standard error
colMedSds and rowMedSds; based on boot
set.seed(2014); ra1 <- c(rnorm(9,2,1),runif(8,1,2)) rat1 <- ratioAllComb(ra1[1:9],ra1[10:17]) median(rat1); stdErrMedBoot(rat1)set.seed(2014); ra1 <- c(rnorm(9,2,1),runif(8,1,2)) rat1 <- ratioAllComb(ra1[1:9],ra1[10:17]) median(rat1); stdErrMedBoot(rat1)
summarizeCols summarizes all columns of matrix (or data.frame).
In case of text-columns the sorted middle (~median) will be given, unless 'maxAbsLast', 'minAbsLast',
.. consider only last column of 'matr' : choose from all columns the line where (max of) last col is at min;
'medianComplete' or 'meanComplete' consideres only lines/rows where no NA occur (NA have influence other columns !)
summarizeCols( matr, meth = "median", refCol = NULL, nEqu = FALSE, supl = NULL, silent = FALSE, debug = FALSE, callFrom = NULL )summarizeCols( matr, meth = "median", refCol = NULL, nEqu = FALSE, supl = NULL, silent = FALSE, debug = FALSE, callFrom = NULL )
matr |
data.frame matrix of data to be summarized by comlumn (may do different method for text and numeric comlumns) |
meth |
(character) summarization method, may be 'mean','aver','median','sd','CV', 'min','max','first','last','maxOfRef','minOfRef','maxAbsLast','minAbsLast',
'medianComplete' or 'meanComplete', 'n' (number of non- |
refCol |
(character or integr) column to be used as reference |
nEqu |
(logical) if |
supl |
(numeric) supplemental parameters for the various summarizing functions (eg used with |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
The argument method allows options that treat (summarize) all columns independently or to select one line (based on argument refCol)
vector with summary for each column
colSums; if data has subgroups to be used in a tapply-way please see makeNRedMatr
t1 <- matrix(round(runif(30,1,9)),nc=3); rownames(t1) <- letters[c(1:5,3:4,6:4)] summarizeCols(t1, me="median") t(sapply(by(t1,rownames(t1), function(x) x), summarizeCols,me="maxAbsLast")) t3 <- data.frame(ref=rep(11:15,3), tx=letters[1:15], matrix(round(runif(30,-3,2),1), ncol=2), stringsAsFactors=FALSE) by(t3,t3[,1], function(x) x) by(t3,t3[,1], function(x) summarizeCols(x, me="maxAbsLast")) t(sapply(by(t3, t3[,1], function(x) x), summarizeCols, me="maxAbsLast"))t1 <- matrix(round(runif(30,1,9)),nc=3); rownames(t1) <- letters[c(1:5,3:4,6:4)] summarizeCols(t1, me="median") t(sapply(by(t1,rownames(t1), function(x) x), summarizeCols,me="maxAbsLast")) t3 <- data.frame(ref=rep(11:15,3), tx=letters[1:15], matrix(round(runif(30,-3,2),1), ncol=2), stringsAsFactors=FALSE) by(t3,t3[,1], function(x) x) by(t3,t3[,1], function(x) summarizeCols(x, me="maxAbsLast")) t(sapply(by(t3, t3[,1], function(x) x), summarizeCols, me="maxAbsLast"))
This function will count the number of NAs per group (defined by argument grp) while summing over all lines of a matrix or data.frame.
The row-position has no influence on the counting.
Using the argument asRelative=TRUE the result will be given as (average) number of NAs per row and group.
sumNAperGroup( x, grp, asRelative = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )sumNAperGroup( x, grp, asRelative = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )
x |
matrix or data.frame which may contain |
grp |
factor describing which column of 'dat' belongs to which group |
asRelative |
(logical) return as count of |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns an integer vector with count of NAs per group
NA, filter NAs by line presenceFilt
mat <- matrix(1:25, ncol=5) mat[lower.tri(mat)] <- NA sumNAperGroup(mat, rep(1:2,c(3,2))) sumNAperGroup(mat, rep(1:2,c(3,2)), asRelative=TRUE)mat <- matrix(1:25, ncol=5) mat[lower.tri(mat)] <- NA sumNAperGroup(mat, rep(1:2,c(3,2))) sumNAperGroup(mat, rep(1:2,c(3,2)), asRelative=TRUE)
This function returns current date (based on Sys.Date) in different format options.
sysDate(style = "univ1")sysDate(style = "univ1")
style |
(character) choose style (default 'univ1' for very compact style) |
Multiple options for formatting exist : 'univ1' or 'wr' ... (default) compact sytle using day, first 3 letters of English name of month (lowercaps) and last 2 letters of year as ddmmmyy, eg 14jun21
'univ2' ... as ddMmmyy, eg 14Jun21
'univ3' ... as ddMonthyyyy, eg 14June2021
'univ4' ... as ddmonthyyyy, eg 14june2021
'univ5' ... as yyyy-mm-dd (output of Sys.Date()), eg 2021-06-14
'univ6' ... as yyyy-number of day (in year), eg 2021-165
'local1' ... compact sytle using day, first 3 letters of current locale name of month (not necessarily unique !) and last 2 letters of year as ddmmmyy, eg 14jui21
'local2' ... as ddMmmyy, month based on current locale (not necessarily unique !), eg 14Jui21
'local3' ... as ddMonthyyyy, month based on current locale , eg 14Juin2021
'local4' ... as ddmonthyyyy, month based on current locale , eg 14juin2021
'local5' ... as dd-month-yyyy, month based on current locale , eg 14-juin-2021
'local6' ... as yyyymonthddd, month based on current locale , eg 2021juin14
character vector with formatted date
sysDate()sysDate()
This function prints all columns of matrix in plotting region for easier inclusion to reports (default values are set to work for output as A4-sized pdf).
It was made for integrating listings of text to graphical output to devices like png, jpeg or pdf.
tableToPlot( matr, colPos = c(0.05, 0.35, 0.41, 0.56), useCex = 0.7, useAdj = c(0, 1, 1, 0), titOffS = 0, useCol = 1, silent = FALSE, callFrom = NULL )tableToPlot( matr, colPos = c(0.05, 0.35, 0.41, 0.56), useCex = 0.7, useAdj = c(0, 1, 1, 0), titOffS = 0, useCol = 1, silent = FALSE, callFrom = NULL )
matr |
(matrix) main (character) matrix to display |
colPos |
(numeric) postion of columns on x-scale (from 0 to 1) |
useCex |
(numeric) cex expension factor forsiez of text (may be different for each column) |
useAdj |
(numeric) left/cneter/right alignment for text (may be different for each column) |
titOffS |
(numeric) offset for title line (ralive to 'colPos') |
useCol |
color specification for text (may be different for each column) |
silent |
(logical) suppress messages |
callFrom |
(character) allow easier tracking of message(s) produced |
This function was initially designed for listings with small/medium 1st col (eg couner or index), 2nd & 3rd col small and long 3rd col (like file paths).
Obviously, the final number of lines one can pack and still read correctly into the graphical output depends on the size of the device
(on a pdf of size A4 one can pack up to apr. 11O lines).
Of ourse, Sweave, combined with LaTeX, provides a powerful alternative for wrapping text to pdf-output (and further combining text and graphics).
Note: The final result on pdf devices may vary depending on screen-size (ie with of current device), the parameters 'colPos' and 'titOffS' may need some refinements.
Note: In view of typical page/figure layouts like A4, the plotting region will be split to avoid too wide spacing between rows with less than 30 rows.
This function returns NULL (no R-object returned), print 'plot' in current device only
Sweave for more flexible framework
## as example let's make a listing of file-names and associated parameters in current directory mat <- dir() mat <- cbind(no=1:length(mat),fileName=mat,mode=file.mode(mat), si=round(file.size(mat)/1024),path=getwd()) ## Now, we wrap all text into a figure (which could be saved as jpg, pdf etc) tableToPlot(mat[,-1],colPos=c(0.01,0.4,0.46,0.6),titOffS=c(0.05,-0.03,-0.01,0.06)) tableToPlot(mat,colPos=c(0,0.16,0.36,0.42,0.75),useAdj=0.5,titOffS=c(-0.01,0,-0.01,0,-0.1))## as example let's make a listing of file-names and associated parameters in current directory mat <- dir() mat <- cbind(no=1:length(mat),fileName=mat,mode=file.mode(mat), si=round(file.size(mat)/1024),path=getwd()) ## Now, we wrap all text into a figure (which could be saved as jpg, pdf etc) tableToPlot(mat[,-1],colPos=c(0.01,0.4,0.46,0.6),titOffS=c(0.05,-0.03,-0.01,0.06)) tableToPlot(mat,colPos=c(0,0.16,0.36,0.42,0.75),useAdj=0.5,titOffS=c(-0.01,0,-0.01,0,-0.1))
The aim of this function is to provide convenient acces to two-factorial (linear) testing withing the framework of makeMAList including the emprical Bayes shrinkage.
The input data 'datMatr' which should already be organized as limma-type MAList, eg using using makeMAList.
Note: This function uses the Bioconductor package limma (which must be installed).
test2factLimma( datMatr, fac1, fac2, testSynerg = FALSE, testOrientation = "=", addResults = c("lfdr", "FDR", "Mval", "means"), addGenes = NULL, silent = FALSE, callFrom = NULL, debug = FALSE )test2factLimma( datMatr, fac1, fac2, testSynerg = FALSE, testOrientation = "=", addResults = c("lfdr", "FDR", "Mval", "means"), addGenes = NULL, silent = FALSE, callFrom = NULL, debug = FALSE )
datMatr |
matrix or data.frame with lines as indenpendent series of measures (eg different genes) |
fac1 |
(character or factor) vector describing grouping elements of each line of 'datMatr' for first factor, must be of same langth as fac2 |
fac2 |
(character or factor) vector describing grouping elements of each line of 'datMatr' for second factor, must be of same langth as fac1 |
testSynerg |
(logical) decide if factor-interactions (eg synergy) should be tested in model, otherwise additive factors are supposed |
testOrientation |
(character) default (or any non-recignized input) '=', otherwise either '>','gerater','sup','upper' or '<','inf','lower' |
addResults |
(character) vector defining which types of information should be included to output, may be 'lfdr','FDR' (for BY correction), 'Mval' (M values), 'means' (matrix with mean values for each group of replicates) |
addGenes |
(matrix or data.frame) additional information to add to output |
silent |
(logical) suppress messages |
callFrom |
(character) allow easier tracking of messages produced |
debug |
(logical) additional messages for debugging |
This function returns an object of class "MArrayLM" (from limma) containing/enriched by the testing results
makeMAList, single line testing lmFit and the eBayes-family of functions in package limma
set.seed(2014) dat0 <- rnorm(30) + rep(c(10,15,19,20),c(9,8,7,6)) fa <- factor(rep(letters[1:4],c(9,8,7,6))) dat2 <- data.frame(facA=rep(c("-","A","-","A"), c(9,8,7,6)), facB= rep(c("-","-","B","B"), c(9,8,7,6)), dat1=dat0, dat2=runif(30)) grpNa <- sub("-","",sub("\\.","", apply(dat2[,1:2], 1, paste, collapse=""))) test2f <- test2factLimma(t(dat2[,3:4]), dat2$facA, dat2$facB) test2f # just the p-values # Similarly, you can easily summarize results using topTable from limma if(requireNamespace("limma", quietly=TRUE)) { test2g <- test2factLimma(t(dat2[,3:4]), dat2$facA, dat2$facB, addR=FALSE) library(limma) topTable(test2g, coef=1, n=5) topTable(test2g, coef=2, n=5) }set.seed(2014) dat0 <- rnorm(30) + rep(c(10,15,19,20),c(9,8,7,6)) fa <- factor(rep(letters[1:4],c(9,8,7,6))) dat2 <- data.frame(facA=rep(c("-","A","-","A"), c(9,8,7,6)), facB= rep(c("-","-","B","B"), c(9,8,7,6)), dat1=dat0, dat2=runif(30)) grpNa <- sub("-","",sub("\\.","", apply(dat2[,1:2], 1, paste, collapse=""))) test2f <- test2factLimma(t(dat2[,3:4]), dat2$facA, dat2$facB) test2f # just the p-values # Similarly, you can easily summarize results using topTable from limma if(requireNamespace("limma", quietly=TRUE)) { test2g <- test2factLimma(t(dat2[,3:4]), dat2$facA, dat2$facB, addR=FALSE) library(limma) topTable(test2g, coef=1, n=5) topTable(test2g, coef=2, n=5) }
This function returns the mean of the top3 highest values.
top3mean(x, silent = FALSE, debug = FALSE, callFrom = NULL)top3mean(x, silent = FALSE, debug = FALSE, callFrom = NULL)
x |
(numeric vector) main input |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
Generally, NA will be excluded, if all values are NA this finction will return NULL ;
thus, in case of (entirely) unsuitable data (non-numeric ...) NULL will be returned.
If data has subgroups you may try a tapply -way.
This function returns a vector with single numeric value for mean of top3
( returns NULL with invalid input or if all input is NA)
x1 <- c(15:11,NA,16) top3mean(x1)x1 <- c(15:11,NA,16) top3mean(x1)
This function helps making gray-gradients.
Note : The resulting color gradient does not seem linear to the human eye, you may try gray.colors instead
transpGraySca(startGray = 0.2, endGrey = 0.8, nSteps = 5, transp = 0.3)transpGraySca(startGray = 0.2, endGrey = 0.8, nSteps = 5, transp = 0.3)
startGray |
(numeric) gray shade at start |
endGrey |
(numeric) gray shade at end |
nSteps |
(integer) number of levels |
transp |
(numeric) transparency alpha |
character vector (of same length as x) with color encoding
layout(1:2) col1 <- transpGraySca(0.8,0.3,7,0.9) pie(rep(1,length(col1)), col=col1, main="from transpGraySca") col2 <- gray.colors(7,0.9,0.3,alph=0.9) pie(rep(1,length(col2)), col=col2, main="from gray.colors")layout(1:2) col1 <- transpGraySca(0.8,0.3,7,0.9) pie(rep(1,length(col1)), col=col1, main="from transpGraySca") col2 <- gray.colors(7,0.9,0.3,alph=0.9) pie(rep(1,length(col2)), col=col2, main="from gray.colors")
treatTxtDuplicates locates duplictes in character-vector 'x' and return list (length=3) : with $init (initial),
$nRed .. non-redundant text by adding number at end or beginning, and $nrLst .. list-version with indexes per unique entry.
Note : NAs (if multiple) will be renamed to NA_1, NA_2
treatTxtDuplicates( x, atEnd = TRUE, sep = "_", onlyCorrectToUnique = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )treatTxtDuplicates( x, atEnd = TRUE, sep = "_", onlyCorrectToUnique = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )
x |
(character) vector with character-entries to identify (and remove) duplicates |
atEnd |
(logical) decide location of placing the counter (at end or at beginning of ID) (see |
sep |
(character) separator to add before counter when making non-redundant version |
onlyCorrectToUnique |
(logical) if TRUE, return only vector of non-redundant |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
list with $init, $nRed, $nrLst
For simple correction use correctToUnique
treatTxtDuplicates(c("li0",NA,rep(c("li2","li3"),2))) correctToUnique(c("li0",NA,rep(c("li2","li3"),2)))treatTxtDuplicates(c("li0",NA,rep(c("li2","li3"),2))) correctToUnique(c("li0",NA,rep(c("li2","li3"),2)))
This function gets pairwise combinations for 'n' elements; returns matrix with x & y coordinates to form all pairwise groups for 1:n elements
triCoord(n, side = "upper", silent = FALSE, debug = FALSE, callFrom = NULL)triCoord(n, side = "upper", silent = FALSE, debug = FALSE, callFrom = NULL)
n |
(integer) number of elements for making all pair-wise combinations |
side |
(character) "upper" or "lower" |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns a 2-column matrix with indexes for all pairwise combinations of 1:n
upperMaCoord, getPWseparator, indexGroupsFromPW, diffCombin; combn, lower.tri or upper.tri, simpler version upperMaCoord
triCoord(4)triCoord(4)
This function allows more flexible options for calculating a trimmed mean compared to mean (from the base-package).
For example, the trimming may be asymmetric to the median of the data.
trimmedMean( dat, trim = c(l = 0.2, u = 0.2), silent = FALSE, debug = FALSE, callFrom = NULL )trimmedMean( dat, trim = c(l = 0.2, u = 0.2), silent = FALSE, debug = FALSE, callFrom = NULL )
dat |
(numeric) numeric vector |
trim |
(numeric, length=2) specifies how data should get trimmed, lower and upper fraction(s) to exclude have to be assigned separately. The lower and upper fraction may be named 'l' and 'u'. The value 0 means that all (sorted) data on a given side will be used. |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
If the second value of trim is <0.5 it is supposed that this indicates a fraction from the upper end the vector-dat as mean does.
Otherwise, trim=c(l=0.2,u=0.7) will be interpreted indication to use the 20th percentile to 70th percentile of dat.
Please note, that trimmed means - and in particular asymmetric trimmed means - should be used with caution as there is also a risk of introducing bias.
This function returns a (numeric) vector with the trimmed mean
mean (symmetric trimming only)
x <- c(17:11,27:28) mean(x); mean(x, trim=0.15) trimmedMean(x, trim=c(l=0, u=0.7)) # asymmetric trimx <- c(17:11,27:28) mean(x); mean(x, trim=0.15) trimmedMean(x, trim=c(l=0, u=0.7)) # asymmetric trim
This function allows trimming/removing redundant text-fragments (redundant from head or tail) out of character vector 'txt'.
trimRedundText( txt, minNchar = 1, side = "both", spaceElim = FALSE, silent = TRUE, callFrom = NULL, debug = FALSE )trimRedundText( txt, minNchar = 1, side = "both", spaceElim = FALSE, silent = TRUE, callFrom = NULL, debug = FALSE )
txt |
character vector to be treated |
minNchar |
(integer) minumin number of characters that must remain |
side |
(character) may be be either 'both', 'left' or 'right' |
spaceElim |
(logical) optional removal of any heading or tailing white space |
silent |
(logical) suppress messages |
callFrom |
(character) allows easier tracking of messages produced |
debug |
(logical) display additional messages for debugging |
This function returns a modified character vector
rmSharedWords; Inverse search : Find/keep common text keepCommonText; checkUnitPrefix;
you may also look for related functions in package stringr
txt1 <- c("abcd_ccc","bcd_ccc","cde_ccc") trimRedundText(txt1, side="right") # trim from right txt2 <- c("ddd_ab","ddd_bcd","ddd_cde") trimRedundText(txt2, side="left") # trim from lefttxt1 <- c("abcd_ccc","bcd_ccc","cde_ccc") trimRedundText(txt1, side="right") # trim from right txt2 <- c("ddd_ab","ddd_bcd","ddd_cde") trimRedundText(txt2, side="left") # trim from left
This function allows truncating a text vector (or matrix of text) at nMax number of characters with optional adding of truncation/ending sign and trimming after last separator.
truncateVect( x, nMax = 20, sep = NULL, appendChar = "...", startFrom = 1, silent = FALSE, debug = FALSE, callFrom = NULL )truncateVect( x, nMax = 20, sep = NULL, appendChar = "...", startFrom = 1, silent = FALSE, debug = FALSE, callFrom = NULL )
x |
(character or matrix of text) main input, text to be truncated |
nMax |
(integer, length=1) max length in number of characters to be returned |
sep |
(character or |
appendChar |
(character, length=1) optional set of characters to add at end when trucation has happened (default '...'); set to |
startFrom |
(integer, length=1) designes the first character to be extracted (see also |
silent |
(logical) suppress messages |
debug |
(logical) display additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
convenient access to results produced using the functions substr or moderTest2grp.
The user can define the threshold and which type of multiple testing correction should be used
(as long as the multiple testing correction method cited was actually performed as part of testing).
This function builds on substr but offers additional options for trimming at right side of text:
In contrast to substr where the absolute position number has to be given, this function takes
the max desired length of the resulting character vector (argument nMax).
The argument appendChar allows adding extra characters (default '...') indicating that trimmming has been performed.
When doing so, the text will be trimmed further inside to ensure the final length of the resulting text, as defined by argument nMax.
Furthermore, using the argument sep it is possible to respect entities between separators and only cut at/before such separators
(the resulting text vecor may thus be shorter than specified globally with argument nMax).
This function returns a data.frame or matrix (if no annotation added) with values (and annotation) conform to fiter criteria
txt <- c("abc", "abcdefgh", "abc/def/gh") truncateVect(txt, nMax=7, appendChar="..") truncateVect(txt, nMax=7, sep="/", appendChar="..")txt <- c("abc", "abcdefgh", "abc/def/gh") truncateVect(txt, nMax=7, appendChar="..") truncateVect(txt, nMax=7, sep="/", appendChar="..")
Run t.test on each indiv value of x against all its neighbours (=remaining values of same vector) in order to test if tis value is likely to belong to vector x. This represents a repeated leave-one-out testing. Mutiple choices for multiple testing correction are available.
tTestAllVal( x, alph = 0.05, alternative = "two.sided", p.adj = NULL, silent = FALSE, debug = FALSE, callFrom = NULL )tTestAllVal( x, alph = 0.05, alternative = "two.sided", p.adj = NULL, silent = FALSE, debug = FALSE, callFrom = NULL )
x |
matrix or data.frame |
alph |
(numeric) threshold alpha (passed to |
alternative |
(character) will be passed to |
p.adj |
(character) multiple test correction : may be NULL (no correction), "BH","BY","holm","hochberg" or "bonferroni" (but not 'fdr' since this may be confounded with local false discovery rate), see |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns a numeric vector with p-values or FDR (depending on argument p.adj)
set.seed(2016); x1 <- rnorm(100) allTests1 <- tTestAllVal(x1) hist(allTests1,breaks="FD")set.seed(2016); x1 <- rnorm(100) allTests1 <- tTestAllVal(x1) hist(allTests1,breaks="FD")
The aim of this function is to provide help in automatically harmonizing enumerators at the end of sample-names.
When data have same grouped setup/design, many times this is reflected in their names, eg 'A_sample1', 'A_sample2' and 'B_sample1'.
However, human operators may use multiple similar (but not identical) ways of expressing the same meanin, eg writng 'A_Samp_1'.
This function allows testing a panel of different extensions of enumerators and (if recognized) to replace them by a user-defined standard text/enumerator.
Please note that the more recent function rmEnumeratorName offers better/more flexible options.
unifyEnumerator( x, refSep = "_", baseSep = c("\\-", "\\ ", "\\."), suplEnu = c("Repl", "Rep", "R", "Number", "No", "Sample", "Samp"), stringentMatch = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )unifyEnumerator( x, refSep = "_", baseSep = c("\\-", "\\ ", "\\."), suplEnu = c("Repl", "Rep", "R", "Number", "No", "Sample", "Samp"), stringentMatch = TRUE, silent = FALSE, debug = FALSE, callFrom = NULL )
x |
(character) main input |
refSep |
(character) separator for output |
baseSep |
(character) basic seprators to test (you have to protect special characters) |
suplEnu |
(character) additional text |
stringentMatch |
(logical) decide if enumerator text has to be found in all instances or only once |
silent |
(logical) suppress messages |
debug |
(logical) display additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function has been developed for matching series of the same samples passing in parallel through different evaluation software (see R package wrProteo). The way human operators may name things may easily leave room for surprises and this function allows testing only a limited number of common ways of writing. Thus, in any case, the user is advised to inspect the results by eye and - if needed- to adjust the parameters.
Basically enumerator separators can be constructed by combing a base-separator baseSep (like '-', '_' etc) and an enumerator-abbreviation suplEnu.
Then, all possible combinations will be tested if they occur in the text x.
Furthermore, the text searched has to be followd by on or multiple digts at the end of text-entry (decimal comma-separators etc are not allowed).
Thus, if there is other 'free text' following to the right after the enumerator-text this function will not find any enumerators to replace.
The argument stringentMatch allows defining if this text has to be found in all text-entries of x or just one of them.
Whe using stringentMatch=FALSE there is risk that other text not meant to design enumerators may be picked up and modified.
Please note, that with large data-sets (ie many columns) testing/checking a larger panel of enumerator-abreviations may result in slower performance. In cases of larger data-sets it may be more effective to first study the data and then run simple subsitions using sub targeted for this very case.
This function returns a character vector of same length as input x, with it's content as adjusted enumerators
rmEnumeratorName for better/more flexible options; grep or sub(), etc if exact and consistent patterns are known
unifyEnumerator(c("ab-1","ab-2","c-3")) unifyEnumerator(c("ab-R1","ab-R2","c-R3")) unifyEnumerator(c("ab-1","c3-2","dR3"), strin=FALSE);unifyEnumerator(c("ab-1","ab-2","c-3")) unifyEnumerator(c("ab-R1","ab-R2","c-R3")) unifyEnumerator(c("ab-1","c3-2","dR3"), strin=FALSE);
Make report about number of unique and redundant elements of vector 'dat'. Note : fairly slow for long vectors !!
uniqCountReport( dat, frL = NULL, plotDispl = FALSE, tit = NULL, col = NULL, radius = 0.9, sizeTo = NULL, clockwise = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )uniqCountReport( dat, frL = NULL, plotDispl = FALSE, tit = NULL, col = NULL, radius = 0.9, sizeTo = NULL, clockwise = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )
dat |
(charcter or numeric vector) main input where number of unique (and redunant) should be determined |
frL |
(logical) optional (re-)introducing results from |
plotDispl |
(logical) decide if pie-type plot should be produced |
tit |
(character) optional title in plot |
col |
(character) custom colors in pie |
radius |
(numeric) radius passed to |
sizeTo |
(numeric or charcter) optional reference group for size-population relative adjusting overall surface of pie |
clockwise |
(logical) argument passed to pie |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
vector with counts of n (total), nUnique (wo any repeated), nHasRepeated (first of repeated), nRedundant), optional figure
layout(1:2) uniqCountReport(rep(1:7,1:7),plot=TRUE) uniqCountReport(rep(1:3,1:3),plot=TRUE,sizeTo=rep(1:7,1:7))layout(1:2) uniqCountReport(rep(1:7,1:7),plot=TRUE) uniqCountReport(rep(1:3,1:3),plot=TRUE,sizeTo=rep(1:7,1:7))
upperMaCoord gets pairwise combinations for 'n' elements; return matrix with x & y coordinates to form all pairwise groups for n elements.
But no distinction of 'upper' or 'lower' possible like in triCoord
upperMaCoord(n, silent = FALSE, debug = FALSE, callFrom = NULL)upperMaCoord(n, silent = FALSE, debug = FALSE, callFrom = NULL)
n |
(integer) number of elements for making all pair-wise combinations |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns a 2-column matrix wiyh indexes for all pairwise combinations of 1:n
lower.tri, more evolved version triCoord
upperMaCoord(4)upperMaCoord(4)
Compute the Euclidean distance and angle (in radians) for 2-dimensional vectors defined by
start and end points in the first and second columns of argumnents x and y.
vectorDistAngle( x, y, addCoord = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )vectorDistAngle( x, y, addCoord = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )
x |
(numeric matrix or data.frame of 2 column, min 2 rows) describes start & end x-coordinates |
y |
(numeric matrix or data.frame of 2 column, min 2 rows) describes start & end x-coordinates |
addCoord |
(logical) add original start and end-coordinates to output |
silent |
(logical) suppress messages |
debug |
(logical) display additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced). |
The input x and y is considered as describing start- and enc-points of vectors in two-dim space.
Each row of x describes the starting and end-points of separate (and independent) vectors along the x- and y-axis.
Then, the function calculates for each line the **distance** as Euclidean distance and the **angle** as atan2(y_diff, x_diff)' in radians (range: '[-pi, pi]'), measured counterclockwise from the positive x-axis.
This function was designed for movement trajectories or any paired
coordinate data where direction and magnitude matter.
If x and y contain more than 2 columns, these additional columns will be ignored.
This function returns a data.frame with the columns:
`dist` |
Numeric vector of Euclidean distances |
`angle` |
Numeric vector of angles in radians |
Optionally the original start and end-coordinates to output may get added if addCoord=TRUE
x <- matrix(c(0, 3, 0.5, 4, 1, 1), ncol=2, byrow=TRUE) # x: (0,0)→(3,0), (0,0)→(4,0), (0,0)→(0,0) y <- matrix(c(0, 0, 1, 3, 0.5, 5), ncol=2, byrow=TRUE) # y: (0,0)→(0,0), (0,0)→(3,0), (0,0)→(5,0) (vectDist <- vectorDistAngle(x, y)) plot(cbind(x=as.numeric(x),y=as.numeric(y)), main="Example for vectorDistAngle()",las=1) arrows(x[,1],y[,1],x[,2],y[,2]) text(x[,2], 0.1 +y[,2], paste0("dist=",round(vectDist[,1],2), ", angle=",round(vectDist[,2],2)), adj=1)x <- matrix(c(0, 3, 0.5, 4, 1, 1), ncol=2, byrow=TRUE) # x: (0,0)→(3,0), (0,0)→(4,0), (0,0)→(0,0) y <- matrix(c(0, 0, 1, 3, 0.5, 5), ncol=2, byrow=TRUE) # y: (0,0)→(0,0), (0,0)→(3,0), (0,0)→(5,0) (vectDist <- vectorDistAngle(x, y)) plot(cbind(x=as.numeric(x),y=as.numeric(y)), main="Example for vectorDistAngle()",las=1) arrows(x[,1],y[,1],x[,2],y[,2]) text(x[,2], 0.1 +y[,2], paste0("dist=",round(vectDist[,1],2), ", angle=",round(vectDist[,2],2)), adj=1)
Filter Statistical Testing Results in Volcano-Plot Like Fashion
This function allows filtering statistical testing results combined with M-values (log2 fold-change) and other filtering criteria. All suitable values can be extracted from objects created from package wrProteo (and limma) may get used automatically. The outcome can be used for Volcano-plots or exporting tables.
volcanoFilter( Mvalue, pValue = NULL, useComp = 1, filtFin = NULL, FCthrs = NULL, FdrList = NULL, FdrThrs = NULL, FdrType = NULL, signifOnly = TRUE, annotColumn = c("SpecType", "GeneName", "EntryName", "Accession", "Species", "Contam"), silent = FALSE, debug = FALSE, callFrom = NULL )volcanoFilter( Mvalue, pValue = NULL, useComp = 1, filtFin = NULL, FCthrs = NULL, FdrList = NULL, FdrThrs = NULL, FdrType = NULL, signifOnly = TRUE, annotColumn = c("SpecType", "GeneName", "EntryName", "Accession", "Species", "Contam"), silent = FALSE, debug = FALSE, callFrom = NULL )
Mvalue |
(numeric, list or of class 'MArrayLM') vector of M-values (log2 fold-change) or output from |
pValue |
(numeric) statistical testing results, only used in case argument |
useComp |
(integer or character) in case argument |
filtFin |
(logical or matrix) optional vector to provide/include results from other additional filtering (columns should maych columns of |
FCthrs |
(numeric) threshold for M-values (as log2(fold-change)), defaults to 1 |
FdrList |
(vector, matrix or data.frame) additional statistical testing results for multiple testing correction, used for apply |
FdrThrs |
(numeric) threshold for filtering |
FdrType |
(character) choose which multiple correction testing shoulbe used for filtering (only if argument |
signifOnly |
(logical) decide if only filtered data or complete table should be returned |
annotColumn |
(character) additional elements from $annot to extract too if |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function offers support for combined filtering along a significance-threshold (flexible choice of type of multiple testing correction)
combined with M-values (log2 fold-change) and other filtering results (already present in objects from package wrProteo).
Even though basic filtering can be performed using separated vectors (see example below), the main advantage relies on automatically recognizing
the structure of results from testRobustToNAimputation() from package wrProteo.
In case of using with separate vectors the original p-values may be provided without or with multiple-testing corrected values (argument FdrList.
If no multiple-testing correctio is provided it will be calculated using the Benjamini-Hochberg formula from p.adjust.
Note : M-value data is assumed to be log2-transformed ratios !
This function returns a matrix (or in some instances a data.frame) combining (at least) the columns 'FDRvalue', 'Mvalue', 'pValue', 'filtFin' and 'retain'
testRobustToNAimputation and extractTestingResults from package wrProteo, or filter_volcano from package genefilter, p.adjust
set.seed(2025); means1 <- matrix(rnorm(2*95) +seq(1,3, length.out=2*95), ncol=2, byrow=TRUE, dimnames=list(NULL, LETTERS[3:2])) means1 <- rbind(means1, cbind((3:7)/2, c(6:8, -2:-3))) rownames(means1) <- paste0("li_",sprintf(paste0("%03d"), 1:100)) Mval0 <- means1[,1] - means1[,2] Mval1 <- matrix(means1[,1] - means1[,2], ncol=1, dimnames=list(rownames(means1), "C-B")) set.seed(2026); pVal0 <- c(runif(95, max=0.9), (4:8)^(-4:-8)) FdrVal1 <- matrix(p.adjust(pVal0, method="BH"), ncol=1, dimnames=list(rownames(means1), "C-B")) pVal1 <- matrix(pVal0, ncol=1, dimnames=list(rownames(means1), "C-B")) ## with separate entries ... filt1 <- volcanoFilter(Mvalue=Mval1, pValue=pVal1) # separate values tail(signif(filt1, 3)) ## separate entries, retrieve all data for Volcano-Plot filt2 <- volcanoFilter(Mvalue=Mval1, pValue=pVal1, signifOnly=FALSE) # separate values tail(signif(filt2, 3)) plot(filt2[,2], -1*log10(filt2[,3]), col=c("grey","red")[1+filt2[,5]], pch=16, main="Volcano-Plot") ## simulate basic/minimal object from wrProteo Mobj3 <- list(means=means1, BH=FdrVal1, p.value=pVal1) filt3 <- volcanoFilter(Mobj3) tail(signif(filt3, 3))set.seed(2025); means1 <- matrix(rnorm(2*95) +seq(1,3, length.out=2*95), ncol=2, byrow=TRUE, dimnames=list(NULL, LETTERS[3:2])) means1 <- rbind(means1, cbind((3:7)/2, c(6:8, -2:-3))) rownames(means1) <- paste0("li_",sprintf(paste0("%03d"), 1:100)) Mval0 <- means1[,1] - means1[,2] Mval1 <- matrix(means1[,1] - means1[,2], ncol=1, dimnames=list(rownames(means1), "C-B")) set.seed(2026); pVal0 <- c(runif(95, max=0.9), (4:8)^(-4:-8)) FdrVal1 <- matrix(p.adjust(pVal0, method="BH"), ncol=1, dimnames=list(rownames(means1), "C-B")) pVal1 <- matrix(pVal0, ncol=1, dimnames=list(rownames(means1), "C-B")) ## with separate entries ... filt1 <- volcanoFilter(Mvalue=Mval1, pValue=pVal1) # separate values tail(signif(filt1, 3)) ## separate entries, retrieve all data for Volcano-Plot filt2 <- volcanoFilter(Mvalue=Mval1, pValue=pVal1, signifOnly=FALSE) # separate values tail(signif(filt2, 3)) plot(filt2[,2], -1*log10(filt2[,3]), col=c("grey","red")[1+filt2[,5]], pch=16, main="Volcano-Plot") ## simulate basic/minimal object from wrProteo Mobj3 <- list(means=means1, BH=FdrVal1, p.value=pVal1) filt3 <- volcanoFilter(Mobj3) tail(signif(filt3, 3))
This function checks which values of numeric vector 'x' are within range +/- 'fa' x 'ref' (ie within range of reference).
withinRefRange( x, fa, ref = NULL, absRef = TRUE, asInd = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )withinRefRange( x, fa, ref = NULL, absRef = TRUE, asInd = FALSE, silent = FALSE, debug = FALSE, callFrom = NULL )
x |
matrix or data.frame |
fa |
(numeric) absolute or relative tolerance value (numeric, length=1), interpreted according to 'absRef' as absolute or relative to 'x'(ie fa*ref) |
ref |
(numeric) (center) reference value for comparison (numeric, length=1), if not given mean of 'x' (excluding NA or non-finite values) will be used |
absRef |
(logical) return result as absolute or relative to 'x'(ie fa*ref) |
asInd |
(logical) if TRUE return index of which values of 'x' are within range, otherwise return values if 'x' within range |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allows easier tracking of messages produced |
This function returns a numeric vector containing only the values within range of reference
## within 2.5 +/- 0.7 withinRefRange(-5:6,fa=0.7,ref=2.5) ## within 2.5 +/- (0.7*2.5) withinRefRange(-5:6,fa=0.7,ref=2.5,absRef=FALSE)## within 2.5 +/- 0.7 withinRefRange(-5:6,fa=0.7,ref=2.5) ## within 2.5 +/- (0.7*2.5) withinRefRange(-5:6,fa=0.7,ref=2.5,absRef=FALSE)
This functions allows for more options when writing data into csv-files compated to write.csv.
writeCsv( input, inPutFi = NULL, expTy = c("Eur", "US"), imporTy = "Eur", filename = NULL, quote = FALSE, filterCol = NULL, replMatr = NULL, returnOut = FALSE, SYLKprevent = TRUE, digits = 22, silent = FALSE, debug = FALSE, callFrom = NULL )writeCsv( input, inPutFi = NULL, expTy = c("Eur", "US"), imporTy = "Eur", filename = NULL, quote = FALSE, filterCol = NULL, replMatr = NULL, returnOut = FALSE, SYLKprevent = TRUE, digits = 22, silent = FALSE, debug = FALSE, callFrom = NULL )
input |
either matrix or data.frame |
inPutFi |
(character or |
expTy |
(character) 'US' and/or 'Eur' for sparator and decimal type in output |
imporTy |
(character) default 'Eur' (otherwise set to 'US') |
filename |
(character) optional new file name(s) |
quote |
(logical) will be passed to function |
filterCol |
(integer or character) optionally, to export only the columns specified here |
replMatr |
optional, matrix (1st line:search, 2nd li:use for replacing) indicating which characters need to be replaced ) |
returnOut |
(logical) return output as object |
SYLKprevent |
(logical) prevent difficulty when opening file via Excel. In some cases Excel presumes (by error) the SYLK format and produces an error when trying to open files : To prevent this, if necessary, the 1st column-name will be changed from 'ID' to 'Id'. |
digits |
(interger) limit number of signif digits in output (ie file) |
silent |
(logical) suppress messages |
debug |
(logical) for bug-tracking: more/enhanced messages |
callFrom |
(character) allow easier tracking of messages produced |
The main input may be gven as R-object or read from file 'input'. Then, one can (re-)write using specified conversions. An optional filter to select columns (column-name specified via 'filterCol') is available.
The output may be simultaneaously written to multiple formats, as specified in 'expTy', tabulation characters may be converted to avoid accidentally split/shift text to multiple columns. Note: Mixing '.' and ',' as comma separators via text-columns or fused text&data may cause problems lateron, though.
This function writes a file to disk and returns NULL unless returnOut=TRUE
write.csv in write.table, batch reading using this package readCsvBatch
dat1 <- data.frame(ini=letters[1:5],x1=1:5,x2=11:15,t1=c("10,10","20.20","11,11","21,21","33.33"), t2=c("10,11","20.21","kl;kl","az,az","ze.ze")) fiNa <- file.path(tempdir(), paste("test",1:2,".csv",sep="")) writeCsv(dat1, filename=fiNa[1]) dir(path=tempdir(), pattern="cs") (writeCsv(dat1, replM=rbind(bad=c(";",","), replBy="__"), expTy=c("Eur"), returnOut=TRUE, filename=fiNa[2]))dat1 <- data.frame(ini=letters[1:5],x1=1:5,x2=11:15,t1=c("10,10","20.20","11,11","21,21","33.33"), t2=c("10,11","20.21","kl;kl","az,az","ze.ze")) fiNa <- file.path(tempdir(), paste("test",1:2,".csv",sep="")) writeCsv(dat1, filename=fiNa[1]) dir(path=tempdir(), pattern="cs") (writeCsv(dat1, replM=rbind(bad=c(";",","), replBy="__"), expTy=c("Eur"), returnOut=TRUE, filename=fiNa[2]))
This function transforms offset (pariwise-difference) between 'x' & 'y' to ppm (as normalized difference ppm, parts per million, ie (x-y)/y ). This type of expressiong differences is used eg in mass-spectrometry.
XYToDiffPpm(x, y, nSign = NULL, silent = FALSE, debug = FALSE, callFrom = NULL)XYToDiffPpm(x, y, nSign = NULL, silent = FALSE, debug = FALSE, callFrom = NULL)
x |
(numeric) typically for measured variable |
y |
(numeric) typically for theoretical/expected value (vector must be of same length as 'x') |
nSign |
(integer) number of significant digits in output |
silent |
(logical) suppress messages |
debug |
(logical) additional messages for debugging |
callFrom |
(character) allow easier tracking of messages produced |
This function returns a numeric vector of (ratio-) ppm values
ratioToPpm for classical ppm
set.seed(2017); aa <- runif(10,50,900) cbind(x=aa,y=aa+1e-3,ppm=XYToDiffPpm(aa,aa+1e-3,nSign=4))set.seed(2017); aa <- runif(10,50,900) cbind(x=aa,y=aa+1e-3,ppm=XYToDiffPpm(aa,aa+1e-3,nSign=4))